MYD88 Monoclonal antibody

MYD88 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA
Cat No. 67969-1-Ig
Clone No.2E10D3

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA

2E10D3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HL-60 cells, HSC-T6 cells, NIH/3T3 cells, pig spleen tissue, rabbit spleen tissue, Jurkat cells, Raji cells, K-562 cells
Positive IHC detected inhuman liver tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse liver tissue
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:3000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67969-1-Ig targets MYD88 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27659

Product name: Recombinant human MYD88 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-296 aa of BC013589

Sequence: MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP

Predict reactive species
Full Name myeloid differentiation primary response gene (88)
Calculated Molecular Weight 33 kDa
Observed Molecular Weight33 kDa
GenBank Accession NumberBC013589
Gene Symbol MYD88
Gene ID (NCBI) 4615
RRIDAB_2918720
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99836
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MYD88 is a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. MYD88 is the key adaptor protein for the interleukin-1 receptor (IL-1R) and most Toll-like receptors (TLRs), which are essential for innate immunity and pathogen-associated molecular pattern recognition. Mutations in the MyD88 gene lead to the development of cancer in humans and mice suggesting that MyD88 also plays a cell autonomous role in tissue homeostasis.

Protocols

Product Specific Protocols
IF protocol for MYD88 antibody 67969-1-IgDownload protocol
IHC protocol for MYD88 antibody 67969-1-IgDownload protocol
WB protocol for MYD88 antibody 67969-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB

J Control Release

Controlled extracellular vesicles release from aminoguanidine nanoparticle-loaded polylysine hydrogel for synergistic treatment of spinal cord injury

Authors - Shaoke Wang
mouse,humanWB

Phytomedicine

Rice bran active peptide (RBAP) inhibited macrophage differentiation to foam cell and atherosclerosis in mice via regulating cholesterol efflux

Authors - Jianfei Mu
mouseWB

Respir Res

Bhlhe40 deficiency attenuates LPS-induced acute lung injury through preventing macrophage pyroptosis

Authors - Xingxing Hu
ratWB

Inflammation

Chlorogenic Acid Alleviates Hepatic Ischemia-Reperfusion Injury by Inhibiting Oxidative Stress, Inflammation, and Mitochondria-Mediated Apoptosis In Vivo and In Vitro

Authors - Kai Li
mouseWB

Front Bioeng Biotechnol

Polyvinylpyrrolidone-Modified Taxifolin Liposomes Promote Liver Repair by Modulating Autophagy to Inhibit Activation of the TLR4/NF-κB Signaling Pathway.

Authors - Qiteng Ding
mouseWB

Front Pharmacol

Ephedra sinica polysaccharide regulate the anti-inflammatory immunity of intestinal microecology and bacterial metabolites in rheumatoid arthritis

Authors - Yanmiao Ma
Loading...
||
New chat Able
正在加载,请稍候...