MYD88 Monoclonal antibody, PBS Only

• 

  WB analysis using 67969-1-Ig (same clone as 67969-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67969-1-Ig (MYD88 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 67969-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 67969-1-Ig (same clone as 67969-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 67969-1-Ig (MYD88 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67969-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 67969-1-Ig (same clone as 67969-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67969-1-Ig (MYD88 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67969-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67969-1-Ig (same clone as 67969-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67969-1-Ig (MYD88 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67969-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig spleen using 67969-1-Ig (same clone as 67969-1-PBS)

  pig spleen tissue were subjected to SDS PAGE followed by western blot with 67969-1-Ig (MYD88 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67969-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit spleen using 67969-1-Ig (same clone as 67969-1-PBS)

  rabbit spleen tissue were subjected to SDS PAGE followed by western blot with 67969-1-Ig (MYD88 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67969-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 67969-1-Ig (same clone as 67969-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67969-1-Ig (MYD88 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67969-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 67969-1-Ig (same clone as 67969-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67969-1-Ig (MYD88 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67969-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 67969-1-Ig (same clone as 67969-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 67969-1-Ig (MYD88 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67969-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 67969-1-Ig (same clone as 67969-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 67969-1-Ig (MYD88 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67969-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse liver using 67969-1-Ig (same clone as 67969-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse liver tissue using MYD88 antibody (67969-1-Ig, Clone: 2E10D3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67969-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 67969-1-Ig (same clone as 67969-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using MYD88 antibody (67969-1-Ig, Clone: 2E10D3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67969-1-PBS in a different storage buffer formulation.

MYD88 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 67969-1-PBS

Clone No.2E10D3

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

2E10D3

---

Product Information

67969-1-PBS targets MYD88 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27659

  Product name: Recombinant human MYD88 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-296 aa of BC013589

  Sequence: MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP

• Full Name: myeloid differentiation primary response gene (88)
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC013589
• Gene Symbol: MYD88
• Gene ID (NCBI): 4615
• RRID: AB_2918720
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99836
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MYD88 is a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. MYD88 is the key adaptor protein for the interleukin-1 receptor (IL-1R) and most Toll-like receptors (TLRs), which are essential for innate immunity and pathogen-associated molecular pattern recognition. Mutations in the MyD88 gene lead to the development of cancer in humans and mice suggesting that MyD88 also plays a cell autonomous role in tissue homeostasis.