MYD88 Monoclonal antibody, PBS Only

MYD88 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA
Cat No. 67969-1-PBS
Clone No.2E10D3

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, IF-P, ELISA

2E10D3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67969-1-PBS targets MYD88 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27659

Product name: Recombinant human MYD88 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-296 aa of BC013589

Sequence: MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP

Predict reactive species
Full Name myeloid differentiation primary response gene (88)
Calculated Molecular Weight 33 kDa
Observed Molecular Weight33 kDa
GenBank Accession NumberBC013589
Gene Symbol MYD88
Gene ID (NCBI) 4615
RRIDAB_2918720
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ99836
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MYD88 is a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. MYD88 is the key adaptor protein for the interleukin-1 receptor (IL-1R) and most Toll-like receptors (TLRs), which are essential for innate immunity and pathogen-associated molecular pattern recognition. Mutations in the MyD88 gene lead to the development of cancer in humans and mice suggesting that MyD88 also plays a cell autonomous role in tissue homeostasis.

Loading...
||
New chat Able
正在加载,请稍候...