MYH10 Polyclonal antibody

MYH10 Polyclonal Antibody for WB, IF/ICC, IP, ELISA
Cat No. 21403-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IF/ICC, IP, ELISA

Myosin 10, Myosin heavy chain 10, Myosin heavy chain, non-muscle IIb, Myosin-10, NMMHC II-b

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain
Positive IP detected inmouse brain tissue
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:10-1:100
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21403-1-AP targets MYH10 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, rat, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16113

Product name: Recombinant human MYH10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1183-1322 aa of BC150634

Sequence: QEVAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKASKLQNELDNVSTLLEEAEKKGIKFAKDAASL

Predict reactive species
Full Name myosin, heavy chain 10, non-muscle
Calculated Molecular Weight 1985 aa, 230 kDa
Observed Molecular Weight 229 kDa
GenBank Accession NumberBC150634
Gene Symbol MYH10
Gene ID (NCBI) 4628
RRIDAB_10804351
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP35580
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MYH10 (non-muscle II-b, NM IIB) is a member of non-muscle myosin II which plays fundamental roles in the maintenance of cell morphology, cell adhesion, and migration, as well as cell division. MYH10 is mainly present in nerve cells, megakaryocytes, and other non-muscle cells. It has been reported to mediate centrosome reorientation during cell migration and contribute to ciliogenesis. Overexpression of MYH10 has been observed in breast cancer.

Protocols

Product Specific Protocols
IF protocol for MYH10 antibody 21403-1-APDownload protocol
IP protocol for MYH10 antibody 21403-1-APDownload protocol
WB protocol for MYH10 antibody 21403-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
bovineWB,IP,IF

J Agric Food Chem

LncRNA BlncAD1 Modulates Bovine Adipogenesis by Binding to MYH10, PI3K/Akt Signaling Pathway, and miR-27a-5p/CDK6 Axis

Authors - Xin Li
RatWB

Mol Med Rep

Paneth cell ablation increases the small intestinal injury during acute necrotizing pancreatitis in rats.

Authors - Liyan Liu
humanWB,IP,IF

Nature

TMEFF1 is a neuron-specific restriction factor for herpes simplex virus

Authors - Yao Dai
Loading...
||
New chat Able
正在加载,请稍候...