Tested Applications
| Positive WB detected in | mouse heart tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue |
| Positive IP detected in | mouse heart tissue |
| Positive IHC detected in | mouse heart tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse heart tissue |
| Positive FC (Intra) detected in | C2C12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IHC | See 3 publications below |
| IF | See 12 publications below |
| CoIP | See 1 publications below |
Product Information
17283-1-AP targets MYL7 in WB, IHC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11058 Product name: Recombinant human MYL7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-175 aa of BC027915 Sequence: MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE Predict reactive species |
| Full Name | myosin, light chain 7, regulatory |
| Calculated Molecular Weight | 175 aa, 19 kDa |
| Observed Molecular Weight | 19 kDa |
| GenBank Accession Number | BC027915 |
| Gene Symbol | MYL7 |
| Gene ID (NCBI) | 58498 |
| RRID | AB_2250998 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q01449 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MYL7, also known as myosin light chain 2a (MLC2a), is essential for heart development. The expression of MYL7 in heart is predominatantly restricted to the atrium. So its expression has been considered as useful marker for atrial cardiomyocytes.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for MYL7 antibody 17283-1-AP | Download protocol |
| IF protocol for MYL7 antibody 17283-1-AP | Download protocol |
| IHC protocol for MYL7 antibody 17283-1-AP | Download protocol |
| IP protocol for MYL7 antibody 17283-1-AP | Download protocol |
| WB protocol for MYL7 antibody 17283-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Clin Invest 1-Deoxynojirimycin promotes cardiac function and rescues mitochondrial cristae in mitochondrial hypertrophic cardiomyopathy | ||
Nat Commun High-efficiency reprogramming of fibroblasts into cardiomyocytes requires suppression of pro-fibrotic signalling. | ||
Theranostics Thymosin β4 increases cardiac cell proliferation, cell engraftment, and the reparative potency of human induced-pluripotent stem cell-derived cardiomyocytes in a porcine model of acute myocardial infarction. | ||
Cardiovasc Res Angiopoietin-1 enhanced myocyte mitosis, engraftment, and the reparability of hiPSC-CMs for treatment of myocardial infarction. | ||
Stem Cell Reports Mitochondrial Dysfunctions Contribute to Hypertrophic Cardiomyopathy in Patient iPSC-Derived Cardiomyocytes with MT-RNR2 Mutation. | ||
Front Cell Dev Biol HiPS-Endothelial Cells Acquire Cardiac Endothelial Phenotype in Co-culture With hiPS-Cardiomyocytes. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Brice-Emmanuel (Verified Customer) (12-18-2023) | Works very well in WB
|
FH Rebecca (Verified Customer) (10-25-2022) | 20ug of protein were loaded. Transference was performed at 4ºC and 90V for 2h. Antibody incubation was done ON at 4ºC.
![]() |




















