Product Information
66237-1-PBS targets Mammaglobin A in IHC, IF-P, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22485 Product name: Recombinant human SCGB2A2 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-93 aa of BC128252 Sequence: MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF Predict reactive species |
| Full Name | secretoglobin, family 2A, member 2 |
| Calculated Molecular Weight | 93 aa, 10 kDa |
| GenBank Accession Number | BC128252 |
| Gene Symbol | Mammaglobin A |
| Gene ID (NCBI) | 4250 |
| RRID | AB_2881626 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13296 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Mammaglobin A, also known as SCGB2A2, is a member of the secretoglobin superfamily. Mammaglobin A is a breast cancer-associated antigen almost exclusively over-expressed in primary and metastatic human breast cancers, making it a specific molecular marker and a potential therapeutic target for breast cancer. This monoclonal antibody is raised against full-length of 93-amino acid human mammaglobin A.

















