Mammaglobin A Monoclonal antibody

• 

  IHC staining of human breast cancer using 66237-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66237-1-Ig (Mammaglobin A antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66237-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66237-1-Ig (Mammaglobin A antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66237-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66237-1-Ig (Mammaglobin A antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human breast cancer using 66237-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66237-1-Ig (Mammaglobin A antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human breast cancer using 66237-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66237-1-Ig (Mammaglobin A antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66237-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66237-1-Ig (Mammaglobin A antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66237-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66237-1-Ig (Mammaglobin A antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 66237-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66237-1-Ig (Mammaglobin A antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human breast cancer using 66237-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using Mammaglobin A antibody (66237-1-Ig, Clone: 2E5D4 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

Mammaglobin A Monoclonal Antibody for IHC, IF-P, ELISA

Cat No. 66237-1-Ig

Clone No.2E5D4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IHC, IF-P, ELISA

Synonyms

SCGB2A2, 2E5D4, hMAM, Mammaglobin 1, Mammaglobin1

---

Tested Applications

• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human breast cancer tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66237-1-Ig targets Mammaglobin A in IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22485

  Product name: Recombinant human SCGB2A2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-93 aa of BC128252

  Sequence: MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF

• Full Name: secretoglobin, family 2A, member 2
• Calculated Molecular Weight: 93 aa, 10 kDa
• GenBank Accession Number: BC128252
• Gene Symbol: Mammaglobin A
• Gene ID (NCBI): 4250
• RRID: AB_2881626
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q13296
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mammaglobin A, also known as SCGB2A2, is a member of the secretoglobin superfamily. Mammaglobin A is a breast cancer-associated antigen almost exclusively over-expressed in primary and metastatic human breast cancers, making it a specific molecular marker and a potential therapeutic target for breast cancer. This monoclonal antibody is raised against full-length of 93-amino acid human mammaglobin A.