Product Information
85657-5-PBS targets Mammaglobin A in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2887 Product name: Recombinant Human Mammaglobin A protein (rFc Tag) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 19-93 aa of NM_002411.3 Sequence: GSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF Predict reactive species |
| Full Name | secretoglobin, family 2A, member 2 |
| Calculated Molecular Weight | 10 kDa |
| Observed Molecular Weight | 6-10 kDa |
| GenBank Accession Number | NM_002411.3 |
| Gene Symbol | Mammaglobin A |
| Gene ID (NCBI) | 4250 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13296-1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SCGB2A2, also known as mammaglobin A, is a member of the secretoglobin superfamily. It is a breast cancer-associated antigen almost exclusively over-expressed in primary and metastatic human breast cancers, making it a specific molecular marker and a potential therapeutic target for breast cancer. SCGB2A2 is a 93-amino acid protein with a calculated molecular weight of 10.5 kDa.

