Mammaglobin A Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85657-5-RR (same clone as 85657-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85657-5-RR (SCGB2A2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85657-5-PBS in a different storage buffer formulation.

Mammaglobin A Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85657-5-PBS

Clone No.243101F6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

SCGB2A2, hMAM, Mammaglobin 1, Mammaglobin1, Mammaglobin-1

---

Product Information

85657-5-PBS targets Mammaglobin A in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2887

  Product name: Recombinant Human Mammaglobin A protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 19-93 aa of NM_002411.3

  Sequence: GSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF

• Full Name: secretoglobin, family 2A, member 2
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 6-10 kDa
• GenBank Accession Number: NM_002411.3
• Gene Symbol: Mammaglobin A
• Gene ID (NCBI): 4250
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13296-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SCGB2A2, also known as mammaglobin A, is a member of the secretoglobin superfamily. It is a breast cancer-associated antigen almost exclusively over-expressed in primary and metastatic human breast cancers, making it a specific molecular marker and a potential therapeutic target for breast cancer. SCGB2A2 is a 93-amino acid protein with a calculated molecular weight of 10.5 kDa.