MCP-1/CCL2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MCP-1/CCL2 Polyclonal antibody (26161-1-AP)

MCP-1/CCL2 Polyclonal Antibody for WB, FC (Intra), ELISA

Cat No. 26161-1-AP Copied!

Publications (110)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse and More (4)

Applications

WB, IHC, IF, FC (Intra), ELISA

Synonyms

Ccl2, MCP1, MCP-1, C-C motif chemokine 2, CCL 2

• 

  WB analysis of RAW 264.7 using 26161-1-AP

  LPS and Brefeldin A treated RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 26161-1-AP (MCP-1/CCL2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 26161-1-AP

  Untreated RAW 264.7 cells, RAW 264.7 cells (treated with 1 μg/ml LPS 20 hours then add 300 ng/ml Brefeldin A for 4hours) were subjected to SDS PAGE followed by western blot with 26161-1-AP (Mcp1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of RAW 264.7 using 26161-1-AP

  1x10^6 LPS and Brefeldin A treated RAW 264.7 cells were intracellularly stained with 0.25 ug MCP-1/CCL2 Polyclonal antibody (26161-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), and 0.25 ug Isotype Control. Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MCP-1/CCL2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: LPS and Brefeldin A treated RAW 264.7 cells
• Positive FC (Intra) detected in: LPS and Brefeldin A treated RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26161-1-AP targets MCP-1/CCL2 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Cited Reactivity: mouse, rat, pig, chicken, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24085

  Product name: Recombinant mouse Mcp1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 24-148 aa of NM-011333

  Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN

• Full Name: chemokine (C-C motif) ligand 2
• Observed Molecular Weight: 16-20 kDa
• GenBank Accession Number: NM-011333
• Gene Symbol: MCP-1/CCL2
• Gene ID (NCBI): 20296
• RRID: AB_2918100
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10148
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Monocyte chemoattractant protein-1 (MCP-1/CCL2) is one of the key chemokines that regulate migration and infiltration of monocytes/macrophages. Both CCL2 and its receptor CCR2 have been demonstrated to be induced and involved in various diseases. Migration of monocytes from the blood stream across the vascular endothelium is required for routine immunological surveillance of tissues, as well as in response to inflammation.

Publications

What published studies show

Anti-CCL2 antibody (Cat# 26161-1-AP) has accumulated 110 citations across journals including Nature Communications, Neuron, Kidney International, Journal of Experimental Medicine, Phytomedicine, and Free Radical Biology and Medicine. Research fields span macrophage polarization and tumor immunology, cardiovascular disease (atherosclerosis, heart failure), renal pathology (diabetic nephropathy), neuroinflammation, liver disease, wound healing, and diabetes. Primary applications include WB, IF, and IHC.

Automatically generated from the 110 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IHC	Cancer Commun (Lond); Targeting SPHK1 in macrophages remodels the tumor microenvironment and enhances anti-PD-1 immunotherapy efficacy in colorectal cancer liver metastasis.; Authors - Yizhi Zhan
	WB	Kidney Int; Melanocortin 5 receptor signaling protects against podocyte injury in proteinuric glomerulopathies; Authors - Bohan Chen
mouse	WB,IF	Nat Commun; Tenascin C(+) myofibroblasts exacerbate vascular neointimal hyperplasia by propagation of nerve-macrophage interactions in mice.; Authors - Xinran Tong
mouse	WB	J Adv Res; Podocyte TLR4 deletion alleviates diabetic kidney disease through prohibiting PKCδ/SHP-1-dependent ER stress and relieving podocyte damage and inflammation; Authors - Zongze Li
		Neuron; C5aR1+ microglia exacerbate neuroinflammation and cerebral edema in acute brain injury; Authors - Jinpeng Zhou
		J Nanobiotechnology; CCR2-overexpressing mesenchymal stromal cell-derived extracellular vesicles loaded with MPA ameliorate lupus nephritis.; Authors - Yang Hang