Tested Applications
| Positive WB detected in | LPS and Brefeldin A treated RAW 264.7 cells |
| Positive FC (Intra) detected in | LPS and Brefeldin A treated RAW 264.7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 40 publications below |
| IHC | See 13 publications below |
| IF | See 17 publications below |
Product Information
26161-1-AP targets MCP-1/CCL2 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Cited Reactivity | mouse, rat, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24085 Product name: Recombinant mouse Mcp1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 24-148 aa of NM-011333 Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 2 |
| Observed Molecular Weight | 16-20 kDa |
| GenBank Accession Number | NM-011333 |
| Gene Symbol | MCP-1/CCL2 |
| Gene ID (NCBI) | 20296 |
| RRID | AB_2918100 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P10148 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Monocyte chemoattractant protein-1 (MCP-1/CCL2) is one of the key chemokines that regulate migration and infiltration of monocytes/macrophages. Both CCL2 and its receptor CCR2 have been demonstrated to be induced and involved in various diseases. Migration of monocytes from the blood stream across the vascular endothelium is required for routine immunological surveillance of tissues, as well as in response to inflammation.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for MCP-1/CCL2 antibody 26161-1-AP | Download protocol |
| WB protocol for MCP-1/CCL2 antibody 26161-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Neuron C5aR1+ microglia exacerbate neuroinflammation and cerebral edema in acute brain injury | ||
Acta Pharmacol Sin Macrophages promote the transition from myocardial ischemia reperfusion injury to cardiac fibrosis in mice through GMCSF/CCL2/CCR2 and phenotype switching | ||
Int J Mol Sci Enhanced Activation of the S1PR2-IL-1β-Src-BDNF-TrkB Pathway Mediates Neuroinflammation in the Hippocampus and Cognitive Impairment in Hyperammonemic Rats | ||
Inflamm Res Aldosterone induces renal lymphangiogenesis through macrophage-lymphatic endothelial cell transformation and Inhibition by esaxerenone | ||
Front Cell Neurosci Effects of Ischemia on the Migratory Capacity of Microglia Along Collagen Microcontact Prints on Organotypic Mouse Cortex Brain Slices. | ||
Biochem Biophys Res Commun Transcription factor RUNX2 participates in astrocyte-mediated neuropathic pain via transcriptional activation of Ccl2 |



