Use Able AI chat for product recommendations

Mouse Mertk Recombinant monoclonal antibody, PBS Only (Capture)

Mertk Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 87457-2-PBS
Clone No.250615D7

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

EC:2.7.10.1, Mer, Proto-oncogene c-Mer, Receptor tyrosine kinase MerTK, Tyrosine-protein kinase Mer

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87457-2-PBS targets Mertk as part of a matched antibody pair:

MP03042-1: 87457-2-PBS capture and 87457-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2866

Product name: Recombinant Mouse MerTK protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 23-498 aa of NM_008587.2

Sequence: EKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSMF

Predict reactive species
Full Name c-mer proto-oncogene tyrosine kinase
Calculated Molecular Weight110 kDa
Observed Molecular Weight110 kDa, 180 kDa
GenBank Accession NumberNM_008587.2
Gene Symbol Mertk
Gene ID (NCBI) 17289
RRIDAB_3745559
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ60805
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Mertk is predominantly expressed in macrophages, dendritic cells, microglia, and retinal pigment epithelial cells, where it functions as a key regulator of efferocytosis, immune tolerance, and tissue homeostasis. Genetic ablation of Mertk leads to defective apoptotic cell clearance, chronic inflammation, and retinal degeneration, establishing Mertk as a central TAM receptor in innate immune regulation and tissue maintenance.

Loading...
||
New chat

Able

正在加载,请稍候...