Mertk Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Mertk Recombinant monoclonal antibody (87457-2-RR)

• 

  WB analysis using 87457-2-RR

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 87457-2-RR (Mertk antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87457-2-RR

  Biolayer interferometry (BLl) kinetic assays of 87457-2-RR against Mouse Mertk were performed. The affinity constant is 1.25 nM.

Mertk Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87457-2-RR

Clone No.250615D7

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Synonyms

EC:2.7.10.1, Mer, Proto-oncogene c-Mer, Receptor tyrosine kinase MerTK, Tyrosine-protein kinase Mer

---

Tested Applications

• Positive WB detected in: rat kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87457-2-RR targets Mertk in WB, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2866

  Product name: Recombinant Mouse MerTK protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 23-498 aa of NM_008587.2

  Sequence: EKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSMF

• Full Name: c-mer proto-oncogene tyrosine kinase
• Calculated Molecular Weight: 110 kDa
• Observed Molecular Weight: 110 kDa, 180 kDa
• GenBank Accession Number: NM_008587.2
• Gene Symbol: Mertk
• Gene ID (NCBI): 17289
• RRID: AB_3745559
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q60805
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mertk is predominantly expressed in macrophages, dendritic cells, microglia, and retinal pigment epithelial cells, where it functions as a key regulator of efferocytosis, immune tolerance, and tissue homeostasis. Genetic ablation of Mertk leads to defective apoptotic cell clearance, chronic inflammation, and retinal degeneration, establishing Mertk as a central TAM receptor in innate immune regulation and tissue maintenance.