Mitoferrin 1 Monoclonal antibody, PBS Only

• 

  WB analysis of TF-1 using 67593-1-Ig (same clone as 67593-1-PBS)

  TF-1 cells were subjected to SDS PAGE followed by western blot with 67593-1-Ig (Mitoferrin 1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67593-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 67593-1-Ig (same clone as 67593-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67593-1-Ig (Mitoferrin 1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67593-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human spleen using 67593-1-Ig (same clone as 67593-1-PBS)

  human spleen tissue were subjected to SDS PAGE followed by western blot with 67593-1-Ig (Mitoferrin 1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67593-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 67593-1-Ig (same clone as 67593-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67593-1-Ig (Mitoferrin 1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67593-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 67593-1-Ig (same clone as 67593-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 67593-1-Ig (Mitoferrin 1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67593-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 67593-1-Ig (same clone as 67593-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 67593-1-Ig (Mitoferrin 1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67593-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67593-1-Ig (same clone as 67593-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67593-1-Ig (Mitoferrin 1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67593-1-PBS in a different storage buffer formulation.

Mitoferrin 1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67593-1-PBS

Clone No.1B1B2

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

HT015, MFRN, Mitoferrin 1, MSC, MSCP, PRO1278, PRO1584, PRO2217, SLC25A37

---

Product Information

67593-1-PBS targets Mitoferrin 1 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26216

  Product name: Recombinant human SLC25A37 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-44 aa of BC132799

  Sequence: MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSAS

• Full Name: solute carrier family 25, member 37
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC132799
• Gene Symbol: Mitoferrin 1
• Gene ID (NCBI): 51312
• RRID: AB_2882800
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NYZ2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Mitoferrin (mfrn, SLC25A37), which is highly expressed in fetal and adult hematopoietic tissues, is a member of the vertebrate mitochondrial solute carrier family (SLC25) and is located on the mitochondrial inner membrane. It functions as an essential and high-affinity iron importer for the biosynthesis of mitochondrial heme and iron-sulfur cluster in vertebrate erythroblasts. Additionally, since it was identified as a major depressive disorder (MDD) risk gene, it is likely to be used as a potential biomarker of MDD diagnose.