Product Information
67593-1-PBS targets Mitoferrin 1 in WB, Indirect ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26216 Product name: Recombinant human SLC25A37 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-44 aa of BC132799 Sequence: MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSAS Predict reactive species |
Full Name | solute carrier family 25, member 37 |
Observed Molecular Weight | 40 kDa |
GenBank Accession Number | BC132799 |
Gene Symbol | Mitoferrin 1 |
Gene ID (NCBI) | 51312 |
RRID | AB_2882800 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q9NYZ2 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
Mitoferrin (mfrn, SLC25A37), which is highly expressed in fetal and adult hematopoietic tissues, is a member of the vertebrate mitochondrial solute carrier family (SLC25) and is located on the mitochondrial inner membrane. It functions as an essential and high-affinity iron importer for the biosynthesis of mitochondrial heme and iron-sulfur cluster in vertebrate erythroblasts. Additionally, since it was identified as a major depressive disorder (MDD) risk gene, it is likely to be used as a potential biomarker of MDD diagnose.