MultiPro® 5CFLX Anti-Human Fascin (1B5G3)

• 

  Single Cell Sequencing experiment G66321-1-5C on Resting PBMC

  G66321-1-5C was used to stain Resting PBMC and analyzed with 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing kit with Fix-Stain protocol.

• 

  Single Cell Sequencing experiment G66321-1-5C on PBMC treated with 4hr LPS + TI

  G66321-1-5C was used to stain PBMC under 4hr LPS + TI treatment and analyzed with 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing kit with Fix-Stain protocol.

Fascin Monoclonal Antibody for Single Cell (Intra)

Cat No. G66321-1-5C

Clone No.1B5G3

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

Single Cell (Intra)

Synonyms

55 kDa actin bundling protein, FAN1, Fascin, Fascin 1,Fascin, FSCN1, HSN, p55, Singed like protein, SNL

---

Tested Applications

• Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product.

Recommended dilution

• SINGLE CELL (INTRA): <0.5ug/test

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Product Information

G66321-1-5C targets Fascin in Single Cell (Intra) applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Oligo Conjugate
• Type: Monoclonal
• Immunogen:

  CatNo: Ag6074

  Product name: Recombinant human Fascin protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-187 aa of BC000521

  Sequence: MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYS

• Full Name: MultiPro® 5CFLX Anti-Human Fascin (1B5G3)
• Calculated Molecular Weight: 55 kDa
• GenBank Accession Number: BC000521
• Gene Symbol: Fascin
• Gene ID (NCBI): 6624
• ENSEMBL Gene ID: ENSG00000075618
• RRID: AB_3673947
• Conjugate: 5CFLX
• Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGGCCGTTCGCGGTACGCCCATATAAGAAA
• Barcode Sequence: GCCGTTCGCGGTACG
• Form: Liquid
• UNIPROT ID: Q16658
• Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3.
• Storage Conditions: 2-8°C Stable for one year after shipment.

Background Information

Fascin is a highly conserved and ubiquitous actin cross-linking protein that has a major function in cell motility and adhesion. Fascin localizes to a number of highly dynamic cellular structures that require strong mechanical support which include stress fibers and cellular protrusions such as microvilli, microspikes and lamellipodia. Fascin is up-regulated in many human carcinomas. It's a marker for Reed-Sternberg cells in Hodgkin's disease; it is also a highly selective marker for dendritic cells of lymphoid tissues.