Use Able AI chat for product recommendations

MultiPro® 5CFLX Anti-Human IBA1 (Polyclonal)

IBA1 Polyclonal Antibody for Single Cell (Intra)

Cat No. G10904-1-5C

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

Single Cell (Intra)

AIF 1, AIF1, G1, IBA1, IRT 1, Protein G1

Formulation:  PBS, EDTA, Azide
PBS, EDTA, Azide
Conjugate:  5CFLX
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive Single Cell (Intra) detected in10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product.

Recommended dilution

ApplicationDilution
SINGLE CELL (INTRA)<0.5ug/test
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Product Information

G10904-1-5C targets IBA1 in Single Cell (Intra) applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Rabbit / IgG
Class Oligo Conjugate
Type Polyclonal
Immunogen

CatNo: Ag1363

Product name: Recombinant human IBA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-147 aa of BC009474

Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Predict reactive species
Full Name MultiPro® 5CFLX Anti-Human IBA1 (Polyclonal)
Calculated Molecular Weight 17 kDa
GenBank Accession NumberBC009474
Gene Symbol IBA1
Gene ID (NCBI) 199
ENSEMBL Gene IDENSG00000204472
RRIDAB_3673881
Conjugate 5CFLX
Full Oligo SequenceCGGAGATGTGTATAAGAGACAGGGATAGGTGCCGACACCCATATAAGAAA
Barcode SequenceGGATAGGTGCCGACA
FormLiquid
UNIPROT IDP55008
Storage Buffer PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3.
Storage Conditions2-8°C Stable for one year after shipment.

Background Information

What is the molecular weight of IBA1?

The molecular weight of IBA1 is 16.7 kD.


 What is IBA1?

Ionized calcium-binding adaptor molecule 1 (IBA1), also known as Allograft inflammatory factor-1 (AIF-1), is an inflammation-responsive scaffold protein expressed and secreted from macrophages. Microglia response factor (MRF-1) and daintain are also similar, and likely identical, proteins (PMIDs: 29749461, 9630473, 23792284).


 What is the function of IBA1?

IBA1 is necessary for macrophage survival, and it is also a key molecule in proinflammatory activity (PMID: 29749461).


 Where is IBA1 localized?

IBA1 is a cytoplasmic protein, often expressed in immunocytes, macrophages, and microglia. It can be used as a marker for normal (not 'dark') microglia in brain tissue, as IBA1 is expressed by all microglial cell subpopulations (PMIDs: 29749461, 11943136, 26847266, 9630473).


 Is IBA1 upregulated in active immunophages?

Yes; its expression is associated with inflammatory activity (PMID: 29749461).


 How do IBA1-positive microglia differ from microglia that express less or no IBA1?

'Dark' microglia is a recently described phenotype associated with Alzheimer's disease pathology and chronic stress; these dark microglia express decreased IBA1 (often punctiform), and show distinct ultrastructural differences from 'normal' microglia as well as condensed and electron-dense cytoplasm and nucleoplasm. Normal microglia generally display strong, diffuse expression of IBA1. IBA1-positive microglial processes in normal conditions also have a strong tendency to exclusively contact synaptic elements, such as axon terminals, dendritic spines, and synaptic clefts (PMIDs: 29992181, 26847266).


 How is IBA1 related to Alzheimer's disease and pain?

Exacerbated immunoactivity of IBA1, particularly in proximity to amyloid plaques, is prominently featured in AD pathology. IBA1, along with other microglial markers, are also associated with pain, and robust microglial reactions often follow spinal cord injury (PMIDs: 29992181, 23792284).


Protocols

MultiPro™ Cell Surface and Intracellular Staining ProtocolDownload protocol
10x Genomics Cell Surface Protein Only Staining ProtocolDownload protocol
Loading...
||
New chat

Able

正在加载,请稍候...