Product Information
66205-1-PBS targets Myoglobin in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag8979 Product name: Recombinant human MB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-154 aa of BC014547 Sequence: MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG Predict reactive species | 
                                    
| Full Name | myoglobin | 
| Calculated Molecular Weight | 154 aa, 17 kDa | 
| Observed Molecular Weight | 17-18 kDa | 
| GenBank Accession Number | BC014547 | 
| Gene Symbol | Myoglobin | 
| Gene ID (NCBI) | 4151 | 
| RRID | AB_2881596 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein G purification | 
| UNIPROT ID | P02144 | 
| Storage Buffer | PBS only, pH 7.3. | 
| Storage Conditions | Store at -80°C. | 
Background Information
Myoglobin is a cytoplasmic hemoprotein that is expressed primarily in cardiomyocytes and oxidative skeletal muscle fibers, functioning on facilitating oxygen transport and modulating nitric oxide homeostasis within cardiac and skeletal myocytes. Recent studies indicated that myoglobin was also expressed in non-muscle tissues. This antibody well recognized endogenous myoglobin in muscle lysates.



















