Myoglobin Monoclonal antibody

• 

  WB analysis of human skeletal muscle using 66205-1-Ig

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 66205-1-Ig (Myoglobin antibody at dilution of 1:50000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig heart using 66205-1-Ig

  pig heart tissue were subjected to SDS PAGE followed by western blot with 66205-1-Ig (Myoglobin antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat heart using 66205-1-Ig

  rat heart tissue were subjected to SDS PAGE followed by western blot with 66205-1-Ig (Myoglobin antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 66205-1-Ig

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 66205-1-Ig (Myoglobin antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rabbit heart using 66205-1-Ig

  rabbit heart tissue were subjected to SDS PAGE followed by western blot with 66205-1-Ig (Myoglobin antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 66205-1-Ig

  human heart tissue were subjected to SDS PAGE followed by western blot with 66205-1-Ig (Myoglobin antibody at dilution of 1:50000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat heart using 66205-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 66205-1-Ig (Myoglobin antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human heart using 66205-1-Ig

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 66205-1-Ig (Myoglobin antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of mouse tongue using 66205-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse tongue tissue slide using 66205-1-Ig (Myoglobin antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of C2C12 using 66205-1-Ig

  1X10^6 C2C12 cells were intracellularly stained with 0.4 ug Anti-Human Myoglobin (66205-1-Ig, Clone:1A4F7) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

Myoglobin Monoclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 66205-1-Ig

Clone No.1A4F7

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

MB, 1A4F7, EC:1.11.1.-, EC:1.7.-.-, Nitrite reductase MB

---

Tested Applications

• Positive WB detected in: human skeletal muscle tissue, pig heart tissue, rat heart tissue, mouse heart tissue, rabbit heart tissue, human heart tissue
• Positive IHC detected in: human heart tissue, mouse tongue tissue, rat heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: C2C12 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:80000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

66205-1-Ig targets Myoglobin in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Cited Reactivity: pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8979

  Product name: Recombinant human MB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-154 aa of BC014547

  Sequence: MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG

• Full Name: myoglobin
• Calculated Molecular Weight: 154 aa, 17 kDa
• Observed Molecular Weight: 17-18 kDa
• GenBank Accession Number: BC014547
• Gene Symbol: Myoglobin
• Gene ID (NCBI): 4151
• RRID: AB_2881596
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P02144
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Myoglobin is a cytoplasmic hemoprotein that is expressed primarily in cardiomyocytes and oxidative skeletal muscle fibers, functioning on facilitating oxygen transport and modulating nitric oxide homeostasis within cardiac and skeletal myocytes. Recent studies indicated that myoglobin was also expressed in non-muscle tissues. This antibody well recognized endogenous myoglobin in muscle lysates.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	WB	Stress Biol; Time-restricted feeding relieves high temperature-induced impairment on meat quality by activating the Nrf2/HO-1 pathway, modification of muscle fiber composition, and enriching the polyunsaturated fatty acids in pigs; Authors - Zhaojian Li