• Featured Product
  • KD/KO Validated

N-cadherin Polyclonal antibody

The N-cadherin polyclonal antibody (22018-1-AP) is one of the most highly cited N-cadherin antibodies in the market. It is suitable for WB, IHC, IF/ICC, IF-P, IF-Fro, IP, ELISA and has been referenced in over 1,556 publications.

Cat No. 22018-1-AP
Publications(1556)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (5)

Applications

WB, IHC, IF/ICC, IF-P, IF-Fro, IP, CoIP, ELISA

Cadherin 2, Cadherin-2, CD325, CDH2, CDHN

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, C2C12 cells, HEK-293 cells, HeLa cells, mouse brain tissue, rat brain tissue, HepG2 cells, NCI-H1299 cells, Calu-1 cells, PC-3 cells, NIH/3T3 cells, C6 cells, rat heart tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse heart tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse heart tissue, C2C12 cells
Positive IF-Fro detected inmouse heart tissue
Positive IF/ICC detected inC2C12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22018-1-AP targets N-cadherin in WB, IHC, IF/ICC, IF-P, IF-Fro, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, canine, bovine, hamster, horse, gecko
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16792

Product name: Recombinant human N-cadherin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 421-535 aa of BC036470

Sequence: RISGGDPTGRFAIQTDQNSNDGLVTVVKPIDFEANRMFVLTVAAENQVPLAKGIQHPPQSTATMSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYT

Predict reactive species
Full Name cadherin 2, type 1, N-cadherin (neuronal)
Calculated Molecular Weight 906 aa, 100 kDa
Observed Molecular Weight 130 kDa
GenBank Accession NumberBC036470
Gene Symbol N-cadherin
Gene ID (NCBI) 1000
RRIDAB_2813891
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP19022
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Neuronal cadherin (N-cadherin), also known as cadherin-2 (CDH2), is a calcium-binding protein that mediates cell-cell adhesions of neuronal and some non-neuronal cell types. 

What is the molecular weight of N-cadherin? Is N-cadherin post-translationally modified?

The molecular weight of mature N-cadherin is 127 kDa. N-cadherin is synthesized in a precursor form that undergoes proteolytic cleavage by furin at the Golgi apparatus. Additionally, it can be phosphorylated by casein kinase II and N-glycosylated, which affects its stability (PMID: 12604612 and 19846557). 

What is the subcellular localization of N-cadherin? What is the tissue expression pattern of N-cadherin?

N-cadherin is an integral membrane protein present at the plasma membrane, forming adherens junctions. It is widely expressed in the nervous system, where it flanks the active zone of synapses and is important for synapse formation and remodeling. It is also present in the lens, skeletal, and cardiac muscles (PMID: 3857614). In the muscle, N-cadherin plays a role in myoblast differentiation, while in the heart it is required for the formation of intercalated discs. Additionally, N-cadherin is present in blood vessels, promoting angiogenesis by forming adhesive complexes between endothelial cells and pericytes (PMID: 24521477). 

What is the role of N-cadherin during the epithelial-mesenchymal transition (EMT)?

EMT is a crucial process during gastrulation that leads to the formation of mesenchymal cells. It is marked by decreased expression of E-cadherin and upregulation of N-cadherin, which promotes cell migration (PMID: 23481201). Similarly, upregulation of N-cadherin is observed in many cancer cell types and is associated with increased invasiveness and metastasis.

Protocols

Product Specific Protocols
IF protocol for N-cadherin antibody 22018-1-APDownload protocol
IHC protocol for N-cadherin antibody 22018-1-APDownload protocol
IP protocol for N-cadherin antibody 22018-1-APDownload protocol
WB protocol for N-cadherin antibody 22018-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB,IHC

Mol Cancer

lncRNA ZNRD1-AS1 promotes malignant lung cell proliferation, migration, and angiogenesis via the miR-942/TNS1 axis and is positively regulated by the m6A reader YTHDC2

Authors - Jin Wang
mouseWB

ACS Nano

Cancer-Erythrocyte Hybrid Membrane-Camouflaged Magnetic Nanoparticles with Enhanced Photothermal-Immunotherapy for Ovarian Cancer.

Authors - Jiaqiang Xiong
mouseWB

ACS Nano

Biomimetic Nanomedicine Targeting Orchestrated Metabolism Coupled with Regulatory Factors to Disrupt the Metabolic Plasticity of Breast Cancer

Authors - Lingtong Meng
humanWB

Nat Commun

Parvimonas micra promotes oral squamous cell carcinoma metastasis through TmpC-CKAP4 axis

Authors - Houbao Qi
humanIHC

Nat Commun

Schwann cells regulate tumor cells and cancer-associated fibroblasts in the pancreatic ductal adenocarcinoma microenvironment

Authors - Meilin Xue
humanWB

Cell Death Differ

TRIM32 promotes anoikis resistance and metastasis in NSCLC by degrading CHEK2 to enhance IL-6 secretion

Authors - Jia Xu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Dhanwini (Verified Customer) (09-24-2025)

GOOD

  • Applications: Western Blot
FH

Robert (Verified Customer) (09-24-2025)

Works really well, used for western.

  • Applications: Western Blot, Other
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HCET
FH

Sneha (Verified Customer) (09-24-2025)

GOOD

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: ARPE-19
FH

Zeeshan (Verified Customer) (09-18-2025)

Work very good, bands are sharp

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Muller glia
FH

Michael (Verified Customer) (09-18-2025)

Great with western blot!

  • Applications: Western Blot, Immunofluorescence, Cell culture
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Corneal cells
FH

Henry (Verified Customer) (09-12-2025)

Perfect westerns and IFA

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Flow Cytometry
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Muller glia and macrophages
FH

CHI (Verified Customer) (11-25-2024)

The antibody works great for IF

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: iPSC-induced cardiomyocytes
N-cadherin Antibody Immunohistochemistry validation (1:200 dilution) in iPSC-induced cardiomyocytes (Cat no:22018-1-AP)
FH

Greta (Verified Customer) (02-08-2024)

Good antibody for WB

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Rat cardiac fibroblasts
FH

Sarah (Verified Customer) (01-04-2024)

Signal at 1:500 was very weak and grainy by immunofluorescence of fixed HCT116 cells.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: HCT116 cells.
FH

Sarah (Verified Customer) (02-09-2023)

Worked well for western blot of mouse brain for 1hr at room temp

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Mouse brain
FH

Ralph (Verified Customer) (05-17-2022)

The antibody works well in indirect immunofluorescence, stains the cell membrane.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: NIH 3T3
FH

Saba (Verified Customer) (02-21-2022)

The band intensity of the antibody is so sharp even in very diluted concentration.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
FH

Lianjie (Verified Customer) (07-26-2019)

Works very well.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Mouse embryonic heart
N-cadherin Antibody Immunofluorescence, validation (1:200 dilution) in Mouse embryonic heart (Cat no:22018-1-AP)
FH

Aurelie (Verified Customer) (06-13-2019)

Great antibody, no background, works also in human U2OS and primary fibroblasts with the same efficiency.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Mouse Cortex/human cell lines
N-cadherin Antibody Western Blot, validation (1/1000 dilution) in Mouse Cortex/human cell lines (Cat no:22018-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...