NAB2 Monoclonal antibody

• 

  WB analysis using 68322-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68322-1-Ig (NAB2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 68322-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68322-1-Ig (NAB2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

NAB2 Monoclonal Antibody for WB, ELISA

Cat No. 68322-1-Ig

Clone No.1F1E2

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Mouse, Rat

Applications

WB, ELISA

Synonyms

EGR 1 binding protein 2, MADER, NAB2, NGFI A binding protein 2, Protein MADER

---

Tested Applications

• Positive WB detected in: HEK-293 cells, U2OS cells, HSC-T6 cells, NIH/3T3 cells, HeLa cells, A2780 cells, A375 cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68322-1-Ig targets NAB2 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6346

  Product name: Recombinant human NAB2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-320 aa of BC065931

  Sequence: MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGEEEAGSPPFSPPAGGGVPEGTGAGGLAAGGTGGGPDRLEPEMVRMVVESVERIFRSFPRGDAGEVTSLLKLNKKLARSVGHIFEMDDNDSQKEEEIRKYSIIYGRFDSKRREGKQLSLHEL

• Full Name: NGFI-A binding protein 2 (EGR1 binding protein 2)
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC065931
• Gene Symbol: NAB2
• Gene ID (NCBI): 4665
• RRID: AB_3085056
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15742
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NGFI-A-Binding protein 2 (NAB2) is a member of the poly(A)-binding protein (PABP) family in S. cerevisiae and emerged as a key component in the tightly intertwined system of poly(A) tail length control, mRNP formation, and export of mature mRNPs.