• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Nucleolin/C23 Polyclonal antibody

Nucleolin/C23 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-10556

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

nucleolin, C23, Protein C23, NCL, FLJ45706

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHEK-293 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10556 targets Nucleolin/C23 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0859

Product name: Recombinant human NCL protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-482 aa of BC006494

Sequence: MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE

Predict reactive species
Full Name nucleolin
Calculated Molecular Weight 76 kDa
Observed Molecular Weight 100-110 kDa
GenBank Accession NumberBC006494
Gene Symbol NCL
Gene ID (NCBI) 4691
RRIDAB_2918986
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP19338
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Nucleolin, also known as C23, involved in the control of transcription of ribosomal RNA (rRNA) genes by RNA polymerase I, in nucleocytoplasmic transportation of ribosomal components, and in ribosome maturation and assembly. It associated with intranucleolar chromatin and pre-ribosomal particles, and induced chromatin decondensation by binding to histione H1. Also it has a role in the process of transcriptional elongation. Whilst mammalian nucleolin has a predicted molecular mass of approximately 77 kDa, the apparent molecular mass is between 100 and 110 kDa, and has been attributed to the amino acid composition of the N-terminal domain, which is highly phosphorylated. (PMID: 15925566)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Nucleolin/C23 antibody CL488-10556Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...