NCR3/NKp30 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00833-4

  Sandwich ELISA standard curve of MP00833-4, Human NCR3/NKp30 Recombinant Matched Antibody Pair - PBS only. 83882-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg31663. 83882-5-PBS was HRP conjugated as the detection antibody. Range: 15.6-1000 pg/mL.

• 

  Sample test of MP00833-4

  Serum of eight individual healthy human donors was measured. The NCR3 concentration of detected samples was determined to be 143.6 pg/mL with a range of 77.4 - 279.5 pg/mL.

NCR3/NKp30 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83882-4-PBS

Clone No.240809G11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

NCR3, 1C7, CD337, LY117, MALS

---

Product Information

83882-4-PBS targets NCR3/NKp30 as part of a matched antibody pair:

MP00833-4: 83882-4-PBS capture and 83882-5-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg31663

  Product name: Recombinant Human NCR3 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 19-135 aa of BC052582

  Sequence: LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG

• Full Name: natural cytotoxicity triggering receptor 3
• Calculated Molecular Weight: 201 aa, 22 kDa
• GenBank Accession Number: BC052582
• Gene Symbol: NCR3
• Gene ID (NCBI): 259197
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14931
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.