Anti-Human NCR3/NKp30 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of human peripheral blood leukocytes using 98365-2-RR (same clone as 98365-2-PBS)

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Anti-Human NCR3/NKp30 Rabbit RecAb (98365-2-RR, Clone: 243109B11) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Human NCAM1/CD56. Cells were not fixed. This data was developed using the same antibody clone with 98365-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98365-2-RR

  Biolayer interferometry (BLl) kinetic assays of 98365-2-RR against Human NCR3/NKp30 were performed. The affinity constant is 0.403 nM.

NCR3/NKp30 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98365-2-PBS

Clone No.243109B11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

NCR3, 1C7, CD337, LY117, MALS

---

Product Information

98365-2-PBS targets NCR3/NKp30 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg31663

  Product name: Recombinant Human NCR3 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 19-135 aa of BC052582

  Sequence: LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG

• Full Name: natural cytotoxicity triggering receptor 3
• Calculated Molecular Weight: 201 aa, 22 kDa
• GenBank Accession Number: BC052582
• Gene Symbol: NCR3
• Gene ID (NCBI): 259197
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14931
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NKp30 (CD337) (NCR3) is a 30-kDa type I transmembrane protein characterized by a single V-type immunoglobulin (Ig) extracellular domain. NKp30 expression is mostly restricted to NK cells although recent studies found this NCR to be present on the surface of additional immune cells, including γδ T cells and Innate Lymphoid Cells (ILCs). NKp30 is involved in NK cell-mediated killing of various tumor cell lines, virus-infected cells and also of autologous dendritic cells (DCs) during the so-called "editing" process.