CoraLite® Plus 488-conjugated NDUFA4L2 Recombinant monoclonal antibody

NDUFA4L2 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-84498
Clone No.241622B12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

241622B12, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2, NADH-ubiquinone oxidoreductase MLRQ subunit homolog, NUOMS

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84498 targets NDUFA4L2 in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9600

Product name: Recombinant human NDUFA4L2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-87 aa of BC011910

Sequence: MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF

Predict reactive species
Full Name NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2
Calculated Molecular Weight 87 aa, 10 kDa
Observed Molecular Weight 10 kDa
GenBank Accession NumberBC011910
Gene Symbol NDUFA4L2
Gene ID (NCBI) 56901
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NRX3
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

NDUFA4L2 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2), also named as NUOMS, is a HIF-1α target gene that localizes to the mitochondria and belongs to the complex I NDUFA4 subunit family. It downregulates oxygen consumption and Complex I activity in hypoxia. NDUFA4L2 is involved in hypoxic adaptation by decreasing mitochondrial ROS production.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 NDUFA4L2 antibody CL488-84498Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...