Tested Applications
| Positive WB detected in | HeLa cells, mouse brain tissue, HepG2 cells, HEK-293 cells, rat brain tissue, mouse heart tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
85187-1-RR targets NDUFA5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag9995 Product name: Recombinant human NDUFA5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC000813 Sequence: MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI Predict reactive species |
| Full Name | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa |
| Calculated Molecular Weight | 13 kDa |
| Observed Molecular Weight | 13 kDa |
| GenBank Accession Number | BC000813 |
| Gene Symbol | NDUFA5 |
| Gene ID (NCBI) | 4698 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q16718 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NDUFA5, also named as CI-13kD-B and NDUA5, belongs to the complex I NDUFA5 subunit family. It is accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which functions in the transfer of electrons from NADH to the respiratory chain. NDUFA5,an enrichment of mitochondrial protein, can be used as a mitochondrial marker protein(PMID:21360670).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NDUFA5 antibody 85187-1-RR | Download protocol |
| WB protocol for NDUFA5 antibody 85187-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









