NDUFA5 Recombinant monoclonal antibody, PBS Only (Capture)

NDUFA5 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 85187-1-PBS
Clone No.242860B10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

242860B10, B13, CI 13KD B, CI-13kD-B, Complex I 13kD B

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85187-1-PBS targets NDUFA5 as part of a matched antibody pair:

MP01899-1: 85187-1-PBS capture and 85187-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9995

Product name: Recombinant human NDUFA5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-116 aa of BC000813

Sequence: MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI

Predict reactive species
Full Name NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa
Calculated Molecular Weight 13 kDa
Observed Molecular Weight 13 kDa
GenBank Accession NumberBC000813
Gene Symbol NDUFA5
Gene ID (NCBI) 4698
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16718
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

NDUFA5, also named as CI-13kD-B and NDUA5, belongs to the complex I NDUFA5 subunit family. It is accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which functions in the transfer of electrons from NADH to the respiratory chain. NDUFA5,an enrichment of mitochondrial protein, can be used as a mitochondrial marker protein(PMID:21360670).

Loading...
||
New chat

Able

正在加载,请稍候...