Tested Applications
Positive WB detected in | PC-3 cells, COLO 320 cells, HT-29 cells, K-562 cells, THP-1 cells, Caco-2 cells |
Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
67098-1-Ig targets NEU3 in WB, IHC, ELISA applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27272 Product name: Recombinant human NEU3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 193-326 aa of NM_006656.5 Sequence: MPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSE Predict reactive species |
Full Name | sialidase 3 (membrane sialidase) |
Calculated Molecular Weight | 48 kDa |
Observed Molecular Weight | 48-52 kDa |
GenBank Accession Number | NM_006656.5 |
Gene Symbol | NEU3 |
Gene ID (NCBI) | 10825 |
RRID | AB_2882403 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q9UQ49 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for NEU3 antibody 67098-1-Ig | Download protocol |
IHC protocol for NEU3 antibody 67098-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |