NEU3 Monoclonal antibody, PBS Only

• 

  WB analysis of PC-3 using 67098-1-Ig (same clone as 67098-1-PBS)

  WB result of NEU3 antibody (67098-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NEU3 transfected PC-3 cells. This data was developed using the same antibody clone with 67098-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67098-1-Ig (same clone as 67098-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67098-1-Ig (NEU3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67098-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 67098-1-Ig (same clone as 67098-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67098-1-Ig (NEU3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67098-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 67098-1-Ig (same clone as 67098-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 67098-1-Ig (NEU3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67098-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 67098-1-Ig (same clone as 67098-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 67098-1-Ig (NEU3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67098-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-29 using 67098-1-Ig (same clone as 67098-1-PBS)

  HT-29 cells were subjected to SDS PAGE followed by western blot with 67098-1-Ig (NEU3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67098-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 67098-1-Ig (same clone as 67098-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67098-1-Ig (NEU3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67098-1-PBS in a different storage buffer formulation.

• 

  WB analysis of THP-1 using 67098-1-Ig (same clone as 67098-1-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 67098-1-Ig (NEU3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67098-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 67098-1-Ig (same clone as 67098-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 67098-1-Ig (NEU3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67098-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 67098-1-Ig (same clone as 67098-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 67098-1-Ig (NEU3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67098-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 67098-1-Ig (same clone as 67098-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 67098-1-Ig (NEU3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67098-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NEU3 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67098-1-PBS

Clone No.2C9C5

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, IHC, Indirect ELISA

Synonyms

cDNA FLJ78026, FLJ12388, NEU3, NEU3 protein, SIAL3

---

Product Information

67098-1-PBS targets NEU3 in WB, IHC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27272

  Product name: Recombinant human NEU3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 193-326 aa of NM_006656.5

  Sequence: MPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRLEEEAGTPSE

• Full Name: sialidase 3 (membrane sialidase)
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48-52 kDa
• GenBank Accession Number: NM_006656.5
• Gene Symbol: NEU3
• Gene ID (NCBI): 10825
• RRID: AB_2882403
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UQ49
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.