Tested Applications
| Positive WB detected in | pig brain tissue, mouse cerebellum tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, pig cerebellum tissue, rabbit cerebellum tissue, rat cerebellum tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
68284-1-Ig targets NEUROD2 in WB, ELISA applications and shows reactivity with Human, mouse, pig samples.
| Tested Reactivity | Human, mouse, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26068 Product name: Recombinant human NEUROD2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 314-382 aa of BC022481 Sequence: DSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPMYEELNAFFHN Predict reactive species |
| Full Name | neurogenic differentiation 2 |
| Calculated Molecular Weight | 41 kDa |
| Observed Molecular Weight | 41-50 kDa |
| GenBank Accession Number | BC022481 |
| Gene Symbol | NEUROD2 |
| Gene ID (NCBI) | 4761 |
| RRID | AB_2935365 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q15784 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NEUROD2 (Neurogenic differentiation factor 2), is transcriptional regulator that regulates early neuronal differentiation during development (PMID: 7754368). NeuroD2 is expressed in the postnatal cortex and mediate the activity-dependent refinement of thalamocortical axon terminals (PMID: 17453014). NeuroD2 is mainly involved in the development of the cerebellar and hippocampal granular neurons, neurons in the basolateral nucleus of amygdala and the hypothalamic-pituitary axis. Mutantions in NEUROD2 can cause neurodevelopmental disorders including intellectual disability and autism spectrum disorders (PMID: 34188164).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for NEUROD2 antibody 68284-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



