NEUROD2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68284-1-Ig (same clone as 68284-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68284-1-Ig (NEUROD2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68284-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse cerebellum using 68284-1-Ig (same clone as 68284-1-PBS)

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 68284-1-Ig (NEUROD2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68284-1-PBS in a different storage buffer formulation.

NEUROD2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68284-1-PBS

Clone No.2C7B3

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, pig

Applications

WB, Indirect ELISA

Synonyms

bHLHa1, NDRF, NeuroD related factor, NEUROD2, neurogenic differentiation 2

---

Product Information

68284-1-PBS targets NEUROD2 in WB, Indirect ELISA applications and shows reactivity with Human, mouse, pig samples.

• Tested Reactivity: Human, mouse, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26068

  Product name: Recombinant human NEUROD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 314-382 aa of BC022481

  Sequence: DSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPMYEELNAFFHN

• Full Name: neurogenic differentiation 2
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 41-50 kDa
• GenBank Accession Number: BC022481
• Gene Symbol: NEUROD2
• Gene ID (NCBI): 4761
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15784
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NEUROD2 (Neurogenic differentiation factor 2), is transcriptional regulator that regulates early neuronal differentiation during development (PMID: 7754368). NeuroD2 is expressed in the postnatal cortex and mediate the activity-dependent refinement of thalamocortical axon terminals (PMID: 17453014). NeuroD2 is mainly involved in the development of the cerebellar and hippocampal granular neurons, neurons in the basolateral nucleus of amygdala and the hypothalamic-pituitary axis. Mutantions in NEUROD2 can cause neurodevelopmental disorders including intellectual disability and autism spectrum disorders (PMID: 34188164).