Tested Applications
| Positive WB detected in | mouse small intestine tissue | 
| Positive IP detected in | mouse kidney tissue | 
| Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 9 publications below | 
| IHC | See 2 publications below | 
| IF | See 2 publications below | 
Product Information
27190-1-AP targets NHE3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse | 
| Cited Reactivity | human, mouse, pig | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag25637 Product name: Recombinant human SLC9A3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 665-834 aa of BC101669 Sequence: KSTKLGLNQNKKAAKLYKRERAQKRRNSSIPNGKLPMESPAQNFTIKEKDLELSDTEEPPNYDEEMSGGIEFLASVTKDTASDSPAGIDNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFRRLMPFRLSSKSVDSFLQADGPEERPPAALPESTHM Predict reactive species | 
                                    
| Full Name | solute carrier family 9 (sodium/hydrogen exchanger), member 3 | 
| Calculated Molecular Weight | 834 aa, 93 kDa | 
| Observed Molecular Weight | 80-100 kDa | 
| GenBank Accession Number | BC101669 | 
| Gene Symbol | NHE3 | 
| Gene ID (NCBI) | 6550 | 
| RRID | AB_2880793 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P48764 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
SLC9A3, also known as NHE3, belongs to the sodium hydrogen exchange protein family (NHE) and is mainly responsible for regulating the concentration of sodium and hydrogen ions inside and outside the cell. SLC9A3 is a Major apical Na+/H+ exchanger in kidney and intestine, playing an important role in renal and intestine Na+ absorption and blood pressure regulation (PMID:24622516, 2635877). Mutations in SLC9A3 cause Congenital Sodium Diarrhea (PMID: 26358773, 31276831).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NHE3 antibody 27190-1-AP | Download protocol | 
| IP protocol for NHE3 antibody 27190-1-AP | Download protocol | 
| WB protocol for NHE3 antibody 27190-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Hypertension Renal Natriuretic Peptide Receptor-C Deficiency Attenuates NaCl Cotransporter Activity in Angiotensin II-Induced Hypertension. | ||
Hypertension Podocyte Injury Augments Intrarenal Angiotensin II Generation and Sodium Retention in a Megalin-Dependent Manner. | ||
Mol Oncol Ryanodine receptor 2 promotes colorectal cancer metastasis by the ROS/BACH1 axis | ||
J Virol Pemetrexed alleviates piglet diarrhea by blocking the interaction between porcine epidemic diarrhea virus nucleocapsid protein and Ezrin | ||
Food Funct EPA and DHA differentially coordinate the crosstalk between host and gut microbiota and block DSS-induced colitis in mice by a reinforced colonic mucus barrier. | ||
Front Vet Sci Effects of Guava (Psidium guajava L.) Leaf Extract on the Metabolomics of Serum and Feces in Weaned Piglets Challenged by Escherichia coli. | 







