FcZero-rAb® Biotin Anti-Human NKp46/NCR1 Rabbit Recombinant Antibody

• 

  FC experiment of human PBMCs using Biotin-FcA98340

  1x10^6 human PBMCs were surface stained with 0.25 ug Biotin Anti-Human NKp46/NCR1 Rabbit RecAb (Biotin-FcA98340, Clone: 242549D12) or FcZero-rAb™ Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9), and Streptavidin-PE Conjugate (PE-PF00030). Cells were co-stained with FcZero-rAb™ CoraLite®647 Anti-Human NCAM1/CD56 Rabbit Recombinant Antibody (CL647-FcA98033, Clone: 240078A7). Cells were not fixed.

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

NKp46/NCR1 FcZero-rAb^® Recombinant Antibody for FC, ELISA

Cat No. Biotin-FcA98340

Clone No.242549D12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC, ELISA

Synonyms

CD335, hNKp46, LY94, Natural killer cell p46-related protein, NCR 1

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98340 targets NKp46/NCR1 in FC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1364

  Product name: Recombinant Human NKp46/NCR1 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-258 aa of /

  Sequence: QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLR

• Full Name: natural cytotoxicity triggering receptor 1
• Calculated Molecular Weight: 34kDa
• GenBank Accession Number: /
• Gene Symbol: NCR1
• Gene ID (NCBI): 9437
• Conjugate: Biotin
• Excitation/Emission Maxima Wavelengths: -
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O76036-1
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

NKp46, also known as NCR1 or CD335, is an Ig-like superfamily cell surface receptor that is highly conserved in mammals (PMID: 22021440). NKp46 is a type I transmembrane glycoprotein consisting of two extracellular Ig-like domains, a transmembrane domain, and an intracellular tail (PMID: 9730896). It is expressed on NK cells, rare T-cell subsets and a mucosal population of NKp46+ innate lymphoid cells (PMID: 9730896; 22021440). NKp46 is the major triggering receptor involved in the natural cytotoxicity (PMID: 10359120; 10092106; 15356098).