• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® CoraLite® Plus 488 Anti-Human NKp46/NCR1 Rabbit Recombinant Antibody

NKp46/NCR1 FcZero-rAb® Recombinant Antibody for FC
Cat No. CL488-FcA98340
Clone No.242549D12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

CD335, hNKp46, LY94, Natural killer cell p46-related protein, NCR 1

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-FcA98340 targets NKp46/NCR1 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1364

Product name: Recombinant Human NKp46/NCR1 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 22-258 aa of /

Sequence: QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLR

Predict reactive species
Full Name natural cytotoxicity triggering receptor 1
Calculated Molecular Weight34kDa
GenBank Accession Number/
Gene Symbol NCR1
Gene ID (NCBI) 9437
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO76036-1
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

NKp46, also known as NCR1 or CD335, is an Ig-like superfamily cell surface receptor that is highly conserved in mammals (PMID: 22021440). NKp46 is a type I transmembrane glycoprotein consisting of two extracellular Ig-like domains, a transmembrane domain, and an intracellular tail (PMID: 9730896). It is expressed on NK cells, rare T-cell subsets and a mucosal population of NKp46+ innate lymphoid cells (PMID: 9730896; 22021440). NKp46 is the major triggering receptor involved in the natural cytotoxicity (PMID: 10359120; 10092106; 15356098).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 NKp46/NCR1 antibody CL488-FcA98340Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...