NKp46/NCR1/CD335 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP01763-1

  Sandwich ELISA standard curve of MP01763-1, Human NCR1 Recombinant Matched Antibody Pair - PBS only. 85021-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg1364. 85021-1-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL

• 

  Sample test of MP01763-1

  Serum of six individual healthy human donors was measured. The human NCR1 concentration of detected samples was determined to be 0.69 ng/mL with a range of 0.39 - 1.00 ng/mL.

• 

  Sample test of MP01763-1

  NK-92 cells (1 x 10^6 cells/mL) were cultured in DMEM supplemented with 10 % fetal bonive serum, 2.5 mM L-glutamine, 100 U/mL penicillin, and 100 μg/mL streptomycin sulfate. The cell culture supernate was assayed for levels of NCR1 and measured 0.95 ng/mL.

• 

  Cytometric bead array standard curve of MP01763-1

  Cytometric bead array standard curve of MP01763-1, NCR1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85021-2-PBS. Detection antibody: 85021-1-PBS. Standard: Eg1364. Range: 0.313-40 ng/mL.

NKp46/NCR1/CD335 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 85021-1-PBS

Clone No.242549E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

CD335, hNKp46, LY94, Natural killer cell p46-related protein, NCR 1

---

Product Information

85021-1-PBS targets NKp46/NCR1/CD335 as part of a matched antibody pair:

MP01763-1: 85021-2-PBS capture and 85021-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1364

  Product name: Recombinant Human NKp46/NCR1 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-258 aa of /

  Sequence: QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLR

• Full Name: natural cytotoxicity triggering receptor 1
• Calculated Molecular Weight: 34kDa
• GenBank Accession Number: /
• Gene Symbol: NCR1
• Gene ID (NCBI): 9437
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O76036-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.