Tested Applications
| Positive WB detected in | THP-1 cells, LPS treated THP-1 cells |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
NLRP3 expression is relatively low in normal tissues(PMID: 33538177, 35676979, 25524927, 24166187)
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 148 publications below |
| IHC | See 33 publications below |
| IF | See 54 publications below |
| IP | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
68102-1-Ig targets NLRP3 in WB, IHC, IF/ICC, IP, CoIP, ELISA, Cell treatment applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, chicken, zebrafish, bovine |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26289 Product name: Recombinant human NLRP3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 937-1036 aa of NM_001079821 Sequence: MLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW Predict reactive species |
| Full Name | NLR family, pyrin domain containing 3 |
| Calculated Molecular Weight | 118 kDa |
| Observed Molecular Weight | 110 kDa |
| GenBank Accession Number | NM_001079821 |
| Gene Symbol | NLRP3 |
| Gene ID (NCBI) | 114548 |
| RRID | AB_2923634 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q96P20 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NALP3, also named as C1orf7, CIAS1 and PYPAF1, belongs to the NLRP family. NLRP3, a key and eponymous component of the NLRP3 inflammasome, plays a crucial role in innate immunity and inflammation. NALP3 may function as an inducer of apoptosis. It interacts selectively with ASC and this complex may function as an upstream activator of NF-kappa-B signaling.NALP3 inhibits TNF-alpha induced activation and nuclear translocation of RELA/NF-KB p65. Also inhibits transcriptional activity of RELA. NALP3 activates caspase-1 in response to a number of triggers including bacterial or viral infection which leads to processing and release of IL1B and IL18. Defects in NLRP3 are the cause of familial cold autoinflammatory syndrome type 1 (FCAS1) which also known as familial cold urticaria. Defects in NLRP3 are a cause of Muckle-Wells syndrome (MWS) which is urticaria-deafness-amyloidosis syndrome. Defects in NLRP3 are the cause of chronic infantile neurologic cutaneous and articular syndrome (CINCA) which also known as neonatal onset multisystem inflammatory disease (NOMID). NLRP3 has some isoforms with the MW of 106-118 kDa and 75-83 kDa(PMID: 17164409, 34680443).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NLRP3 antibody 68102-1-Ig | Download protocol |
| IHC protocol for NLRP3 antibody 68102-1-Ig | Download protocol |
| WB protocol for NLRP3 antibody 68102-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Bioact Mater Dual-pathway targeted therapy for Parkinson's disease: Biomimetic nanosomes inhibit ferroptosis and pyroptosis through NLRP3 inflammasome regulation | ||
MedComm (2020) Dehydrocostus Lactone Effectively Alleviates Inflammatory Diseases by Covalently and Irreversibly Targeting NLRP3 | ||
Phytomedicine Artesunate ameliorates diabetic xerostomia in rats through regulating oral microbiota and metabolic profile in salivary gland based on NF-κB/NLRP3 signaling pathway | ||
Phytomedicine Geniposide via enema alleviates colitis by modulating intestinal flora and bile acid metabolites, inhibiting S100A8/S100A9/NF-κB, and promoting TGR5 inhibition of NLRP3 inflammasome | ||
Free Radic Biol Med Aristolochic acid I exposure triggers ovarian dysfunction by activating NLRP3 inflammasome and affecting mitochondrial homeostasis | ||
Oxid Med Cell Longev Hydrogen Sulfide Ameliorated High Choline-Induced Cardiac Dysfunction by Inhibiting cGAS-STING-NLRP3 Inflammasome Pathway |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Marion (Verified Customer) (10-27-2025) | Very good product
![]() |
FH Marco (Verified Customer) (07-19-2024) | Worked fine.
|








