NMDAR1/GRIN1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85973-3-RR (same clone as 85973-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85973-3-RR (NMDAR1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85973-3-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 85973-3-RR (same clone as 85973-3-PBS)

  IP result of anti-NMDAR1/GRIN1 (IP:85973-3-RR, 4ug; Detection:85973-3-RR 1:1000) with mouse brain tissue lysate 1720 ug. This data was developed using the same antibody clone with 85973-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85973-3-RR

  Biolayer interferometry (BLl) kinetic assays of 85973-3-RR against Human NMDAR1/GRIN1 were performed. The affinity constant is below 1 pM.

NMDAR1/GRIN1 Uni-rAb^® Recombinant Antibody for WB, IP, Indirect ELISA

Cat No. 85973-3-PBS

Clone No.250535B1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

GRIN1, NMDAR1, GluN1, Glutamate receptor ionotropic, NMDA 1, NMDAR 1

---

Product Information

85973-3-PBS targets NMDAR1/GRIN1 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26093

  Product name: Recombinant human NMDAR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-120 aa of NM_000832

  Sequence: MACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG

• Full Name: glutamate receptor, ionotropic, N-methyl D-aspartate 1
• Calculated Molecular Weight: 105 kDa
• Observed Molecular Weight: 116-120 kDa
• GenBank Accession Number: NM_000832
• Gene Symbol: NMDAR1
• Gene ID (NCBI): 2902
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q05586
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GRIN1 encodes subunit 1 of the N-methyl-D-aspartate (NMDA) receptor, which is a heteromeric glutamate-gated calcium ion channel essential for synaptic function in the brain (PMID: 25864721, PMID: 25864721). NMDARs play important roles in normal brain development and function, such as synaptic plasticity, neural development, learning and memory (PMID: 20716669). NMDAR dysfunction has been associated with several neurological disorders including Parkinson, Alzheimer and Huntington diseases. Disrupted motor learning and long-term synaptic plasticity in mice lacking NMDAR1 in the striatum (PMID: 17015831).