Product Information
85973-3-PBS targets NMDAR1/GRIN1 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag26093 Product name: Recombinant human NMDAR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-120 aa of NM_000832 Sequence: MACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG Predict reactive species |
| Full Name | glutamate receptor, ionotropic, N-methyl D-aspartate 1 |
| Calculated Molecular Weight | 105 kDa |
| Observed Molecular Weight | 116-120 kDa |
| GenBank Accession Number | NM_000832 |
| Gene Symbol | NMDAR1 |
| Gene ID (NCBI) | 2902 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q05586 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
GRIN1 encodes subunit 1 of the N-methyl-D-aspartate (NMDA) receptor, which is a heteromeric glutamate-gated calcium ion channel essential for synaptic function in the brain (PMID: 25864721, PMID: 25864721). NMDARs play important roles in normal brain development and function, such as synaptic plasticity, neural development, learning and memory (PMID: 20716669). NMDAR dysfunction has been associated with several neurological disorders including Parkinson, Alzheimer and Huntington diseases. Disrupted motor learning and long-term synaptic plasticity in mice lacking NMDAR1 in the striatum (PMID: 17015831).





