Tested Applications
| Positive WB detected in | mouse kidney tissue, Jurkat cells, mouse liver tissue | 
| Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | HEK-293 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below | 
Product Information
20493-1-AP targets NME2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag13913 Product name: Recombinant human NME2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC002476 Sequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE Predict reactive species | 
                                    
| Full Name | non-metastatic cells 2, protein (NM23B) expressed in | 
| Calculated Molecular Weight | 152 aa, 17 kDa | 
| Observed Molecular Weight | 17 kDa | 
| GenBank Accession Number | BC002476 | 
| Gene Symbol | NME2 | 
| Gene ID (NCBI) | 4831 | 
| RRID | AB_10695634 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P22392 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
NME2(non-metastatic cells 2, protein) is also named as NDKB(Nucleoside diphosphate kinase B) and NM23B, and belongs to the NDK family. It is involved in the phosphorylation of nucleoside diphosphates, supplying nucleotide pools for DNA/RNA synthesis, and interacts with membrane receptors and constitutes a novel molecular regulatory mechanism of GPCR endocytosis. This protein has 2 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NME2 antibody 20493-1-AP | Download protocol | 
| IHC protocol for NME2 antibody 20493-1-AP | Download protocol | 
| WB protocol for NME2 antibody 20493-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
J Hazard Mater Integrative proteomics and metabolomics approach to elucidate metabolic dysfunction induced by silica nanoparticles in hepatocytes. | ||
Proteomics FHL2-drived molecular network mediated Septin2 knockdown inducing apoptosis in mesangial cell. | ||









