NNMT Polyclonal antibody

• 

  WB analysis using 15123-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 15123-1-AP (NNMT antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 15123-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15123-1-AP (NNMT Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 15123-1-AP

  IP result of anti-NNMT (IP:15123-1-AP, 4ug; Detection:15123-1-AP 1:300) with HepG2 cells lysate 2400ug.

• 

  IHC staining of human stomach cancer using 15123-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15123-1-AP (NNMT antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 15123-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HepG2 cells using 15123-1-AP (NNMT antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  FC experiment of HepG2 using 15123-1-AP

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human NNMT (15123-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

NNMT Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 15123-1-AP

Publications(24)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

EC:2.1.1.1, Nicotinamide N-methyltransferase

---

Tested Applications

• Positive WB detected in: L02 cells, HepG2 cells, mouse liver tissue, rat liver tissue
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 7 publications below
• WB: See 22 publications below
• IHC: See 8 publications below
• IF: See 2 publications below
• IP: See 1 publications below

Product Information

15123-1-AP targets NNMT in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7197

  Product name: Recombinant human NNMT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-264 aa of BC000234

  Sequence: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL

• Full Name: nicotinamide N-methyltransferase
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC000234
• Gene Symbol: NNMT
• Gene ID (NCBI): 4837
• RRID: AB_2153579
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P40261
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NNMT can catalyze the N-methylation of nicotinamide using the universal methyl donor S-adenosyl-L-methionine to form N1-methylnicotinamide and S-adenosyl-L-homocysteine, a predominant nicotinamide/vitamin B3 clearance pathway (PMID: 21823666; 23455543; 8182091). It plays a central role in regulating cellular methylation potential, by consuming S-adenosyl-L-methionine and limiting its availability for other methyltransferases. Actively mediates genome-wide epigenetic and transcriptional changes through hypomethylation of repressive chromatin marks, such as H3K27me3 (PMID: 23455543; PMID: 26571212; PMID: 31043742).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,IF	Cell Rep; Single-cell analysis reveals insights into epithelial abnormalities in ovarian endometriosis; Authors - Jia Yan
human	WB,IHC,IF	Oncogene; Stromal nicotinamide N-methyltransferase orchestrates the crosstalk between fibroblasts and tumour cells in oral squamous cell carcinoma: evidence from patient-derived assembled organoids; Authors - Hui Zhao
mouse	WB	Mol Metab; Disrupted Liver Oxidative Metabolism in Glycine N-Methyltransferase-Deficient Mice is Mitigated by Dietary Methionine Restriction.; Authors - Ferrol I Rome
human	WB	Mol Oncol; Elevated N-methyltransferase expression induced by hepatic stellate cells contributes to the metastasis of hepatocellular carcinoma via regulation of the CD44v3 isoform.; Authors - Jie Li ; KD Validated
human	WB	Front Cell Infect Microbiol; Persistent Exposure to Porphyromonas gingivalis Promotes Proliferative and Invasion Capabilities, and Tumorigenic Properties of Human Immortalized Oral Epithelial Cells.; Authors - Fengxue Geng
human	IHC	Sci Rep; The significance of NAD + metabolites and nicotinamide N-methyltransferase in chronic kidney disease.; Authors - Rina Takahashi

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Kenzo (Verified Customer) (01-05-2024)

This antibody worked for immunofluorescence with a little background

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:10000
• Cell Tissue Type: Mouse brain

FH

Johnny (Verified Customer) (01-07-2022)

products from proteintech have always been reliable.

• Applications: Western Blot