Tested Applications
| Positive WB detected in | L02 cells, HepG2 cells, mouse liver tissue, rat liver tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 ul suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15123-1-AP targets NNMT in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7197 Product name: Recombinant human NNMT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-264 aa of BC000234 Sequence: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL Predict reactive species |
| Full Name | nicotinamide N-methyltransferase |
| Calculated Molecular Weight | 30 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC000234 |
| Gene Symbol | NNMT |
| Gene ID (NCBI) | 4837 |
| RRID | AB_2153579 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P40261 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NNMT can catalyze the N-methylation of nicotinamide using the universal methyl donor S-adenosyl-L-methionine to form N1-methylnicotinamide and S-adenosyl-L-homocysteine, a predominant nicotinamide/vitamin B3 clearance pathway (PMID: 21823666; 23455543; 8182091). It plays a central role in regulating cellular methylation potential, by consuming S-adenosyl-L-methionine and limiting its availability for other methyltransferases. Actively mediates genome-wide epigenetic and transcriptional changes through hypomethylation of repressive chromatin marks, such as H3K27me3 (PMID: 23455543; PMID: 26571212; PMID: 31043742).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for NNMT antibody 15123-1-AP | Download protocol |
| IF protocol for NNMT antibody 15123-1-AP | Download protocol |
| IHC protocol for NNMT antibody 15123-1-AP | Download protocol |
| IP protocol for NNMT antibody 15123-1-AP | Download protocol |
| WB protocol for NNMT antibody 15123-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NNMT Polyclonal antibody (Cat# 15123-1-AP) has accumulated 36 citations in journals including Nature, EMBO Journal, Cell Reports, Oncogene, Advanced Science, Cancer Letters, Molecular Metabolism, and Frontiers in Pharmacology. Associated research fields encompass oncology (colorectal, gastric, ovarian, hepatocellular, renal, and esophageal cancers), metabolic regulation (NAD⁺ homeostasis, lipid and glucose metabolism), fibrosis (renal, pancreatic, hepatic), inflammation, atherosclerosis, and chronic kidney disease.
| Species | Application | Title |
|---|---|---|
Gut Microbes Time-restricted feeding ameliorates non-alcoholic fatty liver disease through modulating hepatic nicotinamide metabolism via gut microbiota remodeling | ||
Adv Sci (Weinh) NNMT-DNMT1 Axis is Essential for Maintaining Cancer Cell Sensitivity to Oxidative Phosphorylation Inhibition
| ||
Adv Sci (Weinh) PRDX6 Prevents NNMT Ubiquitination and Degradation as a Nonenzymatic Mechanism to Promote Ovarian Cancer Progression
| ||
Cancer Lett Liver metastasis or peritoneal metastasis: single-cell RNA sequencing reveals the organotropism in colorectal cancer is driven by distinct partial-EMT processes | ||
Oncogene NNMT-mediated N6-methyladenosine modification of NR4A3 mRNA facilitates lymphatic metastasis of gastric adenocarcinoma |
Reviews
What customers say
Able is busy answering your previous question. Please try again later.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Kenzo (Verified Customer) (01-05-2024) | This antibody worked for immunofluorescence with a little background
|
Johnny (Verified Customer) (01-07-2022) | products from proteintech have always been reliable.
|
