Use Able AI chat for product recommendations

iNOS Polyclonal antibody

iNOS Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 22226-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF, FC (Intra), CoIP, ELISA, Cell treatment, qPCR

NOS2, EC:1.14.13.39, Hepatocyte NOS, HEP-NOS, Inducible NO synthase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCaco-2 cells, RAW 264.7 cells
Positive IHC detected inmouse liver tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inLPS treated RAW 264.7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22226-1-AP targets iNOS in WB, IHC, IF, FC (Intra), CoIP, ELISA, Cell treatment, qPCR applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17567

Product name: Recombinant human NOS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-190 aa of BC130283

Sequence: MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFAT

Predict reactive species
Full Name nitric oxide synthase 2, inducible
Calculated Molecular Weight 1153 aa, 131 kDa
Observed Molecular Weight 110-130 kDa, 65-70 kDa
GenBank Accession NumberBC130283
Gene Symbol iNOS
Gene ID (NCBI) 4843
RRIDAB_2879038
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP35228
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NOS2, also named as iNOS and NOS2A, produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. NO is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission, antimicrobial and antitumoral activities. NOS2 is a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. iNOS has a very short half-life due to rapid degradation by calpain. iNOS monomer is a direct substrate of calpain I and can be cleaved by calpain I at the canonical CaM-binding site(503-532aa) of iNOS, and then a ~70kD band can be detected by western (PMID:11786228).

Protocols

Product Specific Protocols
FC protocol for iNOS antibody 22226-1-APDownload protocol
IHC protocol for iNOS antibody 22226-1-APDownload protocol
WB protocol for iNOS antibody 22226-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Carbohydr Polym

Chitosan-based adhesive patch with anti-inflammatory, pro-healing, and immunomodulatory properties for dural defect repair

Authors - Fenglei Chen
mouseIF

Theranostics

Multifunctionally disordered TiO2 nanoneedles prevent periprosthetic infection and enhance osteointegration by killing bacteria and modulating the osteoimmune microenvironment

Authors - Yangmengfan Chen
mouse,humanWB,IHC

Mol Ther

Epsin1-mediated exosomal sorting of Dll4 modulates the tubular-macrophage crosstalk in diabetic nephropathy

Authors - Jia-Lu Liu
mouseIF

Proc Natl Acad Sci U S A

Sleep deficiency exacerbates periodontal inflammation via trigeminal TRPV1 neurons

Authors - Junhui Li
mouseWB,IF

J Nanobiotechnology

Injectable photocrosslinking spherical hydrogel-encapsulated targeting peptide-modified engineered exosomes for osteoarthritis therapy

Authors - Junlai Wan
mouse,humanIF

Mater Today Bio

Hyaluronic acid-anchored nanoparticles co-delivering emodin and siRNA confers protection against rheumatoid arthritis via macrophage polarization

Authors - Muting Qin
Loading...
||
New chat

Able

正在加载,请稍候...