iNOS Polyclonal antibody

iNOS Polyclonal Antibody for WB, FC (Intra), ELISA

Cat No. 22226-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF, FC (Intra), CoIP, ELISA, Cell treatment

NOS2, EC:1.14.13.39, Hepatocyte NOS, HEP-NOS, Inducible NO synthase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCaco-2 cells, RAW 264.7 cells
Positive FC (Intra) detected inLPS treated RAW 264.7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22226-1-AP targets iNOS in WB, IHC, IF, FC (Intra), CoIP, ELISA, Cell treatment applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17567

Product name: Recombinant human NOS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-190 aa of BC130283

Sequence: MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFAT

Predict reactive species
Full Name nitric oxide synthase 2, inducible
Calculated Molecular Weight 1153 aa, 131 kDa
Observed Molecular Weight 110-130 kDa, 65-70 kDa
GenBank Accession NumberBC130283
Gene Symbol iNOS
Gene ID (NCBI) 4843
RRIDAB_2879038
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP35228
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NOS2, also named as iNOS and NOS2A, produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. NO is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission, antimicrobial and antitumoral activities. NOS2 is a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. iNOS has a very short half-life due to rapid degradation by calpain. iNOS monomer is a direct substrate of calpain I and can be cleaved by calpain I at the canonical CaM-binding site(503-532aa) of iNOS, and then a ~70kD band can be detected by western (PMID:11786228).

Protocols

Product Specific Protocols
FC protocol for iNOS antibody 22226-1-APDownload protocol
WB protocol for iNOS antibody 22226-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Carbohydr Polym

Chitosan-based adhesive patch with anti-inflammatory, pro-healing, and immunomodulatory properties for dural defect repair

Authors - Fenglei Chen
mouseIF

Theranostics

Multifunctionally disordered TiO2 nanoneedles prevent periprosthetic infection and enhance osteointegration by killing bacteria and modulating the osteoimmune microenvironment

Authors - Yangmengfan Chen
mouse,humanWB,IHC

Mol Ther

Epsin1-mediated exosomal sorting of Dll4 modulates the tubular-macrophage crosstalk in diabetic nephropathy

Authors - Jia-Lu Liu
mouseIF

Proc Natl Acad Sci U S A

Sleep deficiency exacerbates periodontal inflammation via trigeminal TRPV1 neurons

Authors - Junhui Li
mouse,humanIF

Mater Today Bio

Hyaluronic acid-anchored nanoparticles co-delivering emodin and siRNA confers protection against rheumatoid arthritis via macrophage polarization

Authors - Muting Qin
mouseWB,IF

J Nanobiotechnology

Injectable photocrosslinking spherical hydrogel-encapsulated targeting peptide-modified engineered exosomes for osteoarthritis therapy

Authors - Junlai Wan
Loading...
||
New chat

Able

正在加载,请稍候...