Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
Product Information
28085-1-AP targets NPC1L1 in WB, IHC, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Cited Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26277 Product name: Recombinant human NPC1L1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 415-514 aa of NM_001101648 Sequence: MPNRSSYRYDSLLLGPKNFSGILDLDLLLELLELQERLRHLQVWSPEAQRNISLQDICYAPLNPDNTSLYDCCINSLLQYFQNNRTLLLLTANQTLMGQTS Predict reactive species |
| Full Name | NPC1 (Niemann-Pick disease, type C1, gene)-like 1 |
| Calculated Molecular Weight | 149 kDa |
| Observed Molecular Weight | 140-149 kDa |
| GenBank Accession Number | NM_001101648 |
| Gene Symbol | NPC1L1 |
| Gene ID (NCBI) | 29881 |
| RRID | AB_2918146 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UHC9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NPC1 like intracellular cholesterol transporter 1 (NPC1L1) is a multi-pass membrane protein which has 1332 amino acids and containing a conserved N-terminal Niemann-Pick C1 (NPC1) domain and a putative sterol-sensing domain (SSD). It is only found in the tubular membranes of primate hepatocytes and the brush-border membranes of the small intestine of mammals. PC1L1 is a key protein for intestinal absorption of cholesterol and plays an important role in cholesterol balance. Cholesterol contributes to cell proliferation, invasion and latency, and is essential for tumor formation and growth, so NPC1L1 plays a critical role in tumor development and spread (PMID: 36034854).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NPC1L1 antibody 28085-1-AP | Download protocol |
| WB protocol for NPC1L1 antibody 28085-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int J Biol Macromol Identification of targets and comparative study of administration methods for the lipid-lowering effects of fucoidan from Saccharina japonica | ||
Foods Efficient Hydrolysis of Earthworm Protein and the Lipid-Lowering Mechanism of Peptides in the Hydrolysate | ||
Biomedicines Co-Expression of Niemann-Pick Type C1-Like1 (NPC1L1) with ACE2 Receptor Synergistically Enhances SARS-CoV-2 Entry and Fusion |





