Tested Applications
| Positive WB detected in | MKN-45 cells, HepG2 cells, HEK-293 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IF | See 1 publications below |
Product Information
81820-2-RR targets NR1H4 in WB, IF, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag21948 Product name: Recombinant human NR1H4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-121 aa of BC130573 Sequence: MGSKMNLIEHSHLPTTDEFSFSENLFGVLTEQVAGPLGQNLEVEPYSQYSNVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTKKPRMGASAGRI Predict reactive species |
| Full Name | nuclear receptor subfamily 1, group H, member 4 |
| Calculated Molecular Weight | 486 aa, 56 kDa |
| Observed Molecular Weight | 48 kDa |
| GenBank Accession Number | BC130573 |
| Gene Symbol | NR1H4 |
| Gene ID (NCBI) | 9971 |
| RRID | AB_3670508 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q96RI1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nuclear Receptor subfamily 1, group H, member 4 (NR1H4, also known as FXR) is a receptor for bile acids and has an important role in regulating energy metabolism in liver, muscle and adipose tissues in humans and animals. NR1H4 is highly expressed in liver and has a role in lipid metabolism, whereas none of the other protein-coding genes in the region has known biological links with cholesterol, further supporting a role for NR1H4 in regulation of cholesterol levels. NR1H4 have four isoforms, i.e., FXRalpha1, FXRalpha2, FXRbeta1, and FXRbeta2, and each isoform has a different expressional level and transcriptional activity depending on its location within specific tissues. (PMID: 14733360, PMID: 30787420)
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for NR1H4 antibody 81820-2-RR | Download protocol |
| WB protocol for NR1H4 antibody 81820-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







