Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

NR1H4 Recombinant monoclonal antibody, PBS Only

NR1H4 Uni-rAb® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 81820-2-PBS
Clone No.4B4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Indirect ELISA

4B4, BAR, Bile acid receptor, Farnesoid X activated receptor, Farnesoid X-activated receptor

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81820-2-PBS targets NR1H4 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag21948

Product name: Recombinant human NR1H4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-121 aa of BC130573

Sequence: MGSKMNLIEHSHLPTTDEFSFSENLFGVLTEQVAGPLGQNLEVEPYSQYSNVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTKKPRMGASAGRI

Predict reactive species
Full Name nuclear receptor subfamily 1, group H, member 4
Calculated Molecular Weight 486 aa, 56 kDa
Observed Molecular Weight 48 kDa
GenBank Accession NumberBC130573
Gene Symbol NR1H4
Gene ID (NCBI) 9971
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96RI1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Nuclear Receptor subfamily 1, group H, member 4 (NR1H4, also known as FXR) is a receptor for bile acids and has an important role in regulating energy metabolism in liver, muscle and adipose tissues in humans and animals. NR1H4 is highly expressed in liver and has a role in lipid metabolism, whereas none of the other protein-coding genes in the region has known biological links with cholesterol, further supporting a role for NR1H4 in regulation of cholesterol levels. NR1H4 have four isoforms, i.e., FXRalpha1, FXRalpha2, FXRbeta1, and FXRbeta2, and each isoform has a different expressional level and transcriptional activity depending on its location within specific tissues. (PMID: 14733360, PMID: 30787420)

Loading...
||
New chat

Able

正在加载,请稍候...