Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, DU 145 cells, mouse brain tissue, rat brain tissue, PC-12 cells |
| Positive IP detected in | HepG2 cells, mouse heart tissue |
| Positive IHC detected in | human prostate cancer tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 12 publications below |
| WB | See 80 publications below |
| IHC | See 10 publications below |
| IF | See 19 publications below |
| IP | See 3 publications below |
| CoIP | See 5 publications below |
| ChIP | See 21 publications below |
Product Information
24050-1-AP targets Glucocorticoid receptor in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, chicken, zebrafish, rare minnow |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21146 Product name: Recombinant human Glucocorticoid receptor protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC015610 Sequence: MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPI Predict reactive species |
| Full Name | nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor) |
| Calculated Molecular Weight | 86 kDa |
| Observed Molecular Weight | 94-97 kDa |
| GenBank Accession Number | BC015610 |
| Gene Symbol | Glucocorticoid receptor |
| Gene ID (NCBI) | 2908 |
| RRID | AB_2813890 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P04150 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Glucocorticoid receptor (GR, or GCR) also known as NR3C1 (nuclear receptor subfamily 3, group C, member 1) is a receptor for glucocorticoids, which owns a dual mode of action: as a transcription factor that binds to glucocorticoid response elements (GRE) and as a modulator of other transcription factors. It is involved in cell proliferation and differentiation and specifically implicated in newborn birth weight, thus providing a biological mechanism by which NR3C1 expression may influence birth weight (PMID:22810058).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Glucocorticoid receptor antibody 24050-1-AP | Download protocol |
| IHC protocol for Glucocorticoid receptor antibody 24050-1-AP | Download protocol |
| IP protocol for Glucocorticoid receptor antibody 24050-1-AP | Download protocol |
| WB protocol for Glucocorticoid receptor antibody 24050-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab A macrophage-hepatocyte glucocorticoid receptor axis coordinates fasting ketogenesis. | ||
Cell Metab Individual-specific functional epigenomics reveals genetic determinants of adverse metabolic effects of glucocorticoids. | ||
Sci Adv Small-molecule inhibitor targeting orphan nuclear receptor COUP-TFII for prostate cancer treatment. | ||
Mol Cell Cistromic Reprogramming of the Diurnal Glucocorticoid Hormone Response by High-Fat Diet. | ||
Mol Psychiatry The co-chaperone Fkbp5 shapes the acute stress response in the paraventricular nucleus of the hypothalamus of male mice. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Ping (Verified Customer) (06-04-2019) | This antibody works well for immunoprecipitation and western blot.
|
FH Yu Siong (Verified Customer) (04-23-2019) | Multiple bands observed - Total of 5 bands, not suitable for porcine brain endothelial cells, as non-specific binding tend to occur.Consistent in two Independent experiments
|
FH Praveen (Verified Customer) (02-25-2019) | WORKS VERY WELL.
|
FH Shubham (Verified Customer) (01-31-2019) | Antibody works great.
![]() |






























