Tested Applications
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL594-66063 targets NTF2 in IF applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag7879 Product name: Recombinant human NUTF2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 10-127 aa of BC002348 Sequence: IGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG Predict reactive species |
Full Name | nuclear transport factor 2 |
Calculated Molecular Weight | 14 kDa |
Observed Molecular Weight | 13 kDa |
GenBank Accession Number | BC002348 |
Gene Symbol | NTF2 |
Gene ID (NCBI) | 10204 |
RRID | AB_2883499 |
Conjugate | CoraLite®594 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P61970 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
NUTF2 (nuclear transport factor 2), also named as NTF2, is a cytosolic protein responsible for nuclear import of Ran, a small Ras-like GTPase involved in a number of critical cellular processes, including cell cycle regulation, chromatin organization during mitosis, reformation of the nuclear envelope following mitosis, and controlling the directionality of nucleocytoplasmic transport. Nucleocytoplasmic translocation of NTF2 is regulated in mammalian cells, and may involve a tyrosine and/or threonine kinase-dependent signal transduction mechanism(s) (PMID: 22880006). The MW of this protein is 14 kDa, and this antibody specially recognises the 14 kDa protein.
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL594 NTF2 antibody CL594-66063 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |