NUCB2/nesfatin-1 Recombinant monoclonal antibody

NUCB2/nesfatin-1 Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83917-2-RR
Clone No.241037D8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

NUCB2, nucleobindin 2, NEFA, Gastric cancer antigen Zg4, DNA binding protein NEFA

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, mouse testis tissue, C6 cells, mouse spleen tissue, mouse brain tissue, rat brain tissue
Positive FC (Intra) detected inHepG2 cells, A431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83917-2-RR targets NUCB2/nesfatin-1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25152

Product name: Recombinant human NUCB2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-106 aa of NM_005013

Sequence: VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL

Predict reactive species
Full Name nucleobindin 2
Calculated Molecular Weight 50 kDa
Observed Molecular Weight 45-50 kDa
GenBank Accession NumberNM_005013
Gene Symbol NUCB2
Gene ID (NCBI) 4925
RRIDAB_3671495
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP80303
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NucB2, an anorexigenic molecule, is expressed mainly in the hypothalamus, particularly in the supraoptic nucleus (SON) and the paraventricular nucleus (PVN). NucB2 is also expressed in the subfornical organ (SFO). Because the SON and PVN are involved in body fluid regulation, NucB2 may be involved in dehydration-induced anorexia. NUCB2 is composed of a signal peptide of 24 amino acids in the N-terminal region and a protin structure containing 396 amino acids. Nesfatin-1 is an 82-amino-acid peptide hormone cleaved from nucleobindin2 (NUCB2).

Protocols

Product Specific Protocols
WB protocol for NUCB2/nesfatin-1 antibody 83917-2-RRDownload protocol
FC protocol for NUCB2/nesfatin-1 antibody 83917-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...