Tested Applications
| Positive WB detected in | HepG2 cells, HEK-293 cells, HeLa cells, K-562 cells, SH-SY5Y cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HEK-293 cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 5 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
Product Information
10681-1-AP targets NUDC in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0998 Product name: Recombinant human NUDC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-331 aa of BC006147 Sequence: MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN Predict reactive species |
| Full Name | nuclear distribution gene C homolog (A. nidulans) |
| Calculated Molecular Weight | 38 kDa |
| Observed Molecular Weight | 42-45 kDa |
| GenBank Accession Number | BC006147 |
| Gene Symbol | NUDC |
| Gene ID (NCBI) | 10726 |
| RRID | AB_2282933 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y266 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Nuclear distribution protein C (NudC) is a highly conserved dynein/dynactin associated protein implicated in mitosis and cytokinesis. NudC is localized on major mitotic structures, and is involved in regulating spindle formation stability of kinetochore microtubule attachments, and chromosomes congression in early mitosis. NudC also is required for multi-protein transport along axons in neurons.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NUDC antibody 10681-1-AP | Download protocol |
| IHC protocol for NUDC antibody 10681-1-AP | Download protocol |
| IP protocol for NUDC antibody 10681-1-AP | Download protocol |
| WB protocol for NUDC antibody 10681-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Res NudC regulates actin dynamics and ciliogenesis by stabilizing cofilin 1.
| ||
Int J Mol Sci N-Acetyl-D-Glucosamine Kinase Interacts with NudC and Lis1 in Dynein Motor Complex and Promotes Cell Migration. | ||
Mol Cell Biol Substrate Trapping Proteomics Reveals Targets of the βTrCP2/FBXW11 Ubiquitin Ligase. | ||
Front Cell Dev Biol NudC L279P Mutation Destabilizes Filamin A by Inhibiting the Hsp90 Chaperoning Pathway and Suppresses Cell Migration. | ||
Reprod Domest Anim Proteomic-based identification of oocyte maturation-related proteins in mouse germinal vesicle oocytes. |



















