Tested Applications
| Positive IP detected in | mouse kidney tissue |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 4 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
26184-1-AP targets SLC13A3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24182 Product name: Recombinant human SLC13A3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 161-229 aa of BC035966 Sequence: SLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRN Predict reactive species |
| Full Name | solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 |
| Calculated Molecular Weight | 602 aa, 67 kDa |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC035966 |
| Gene Symbol | SLC13A3 |
| Gene ID (NCBI) | 64849 |
| RRID | AB_2868533 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8WWT9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC13A3, also named NADC3 and SDCT2, belongs to the SLC13A/DASS transporter (TC 2.A.47) family and NADC subfamily. SLC13A3 encodes the plasma membrane Na+ /Dicarboxylate Cotransporter 3 (NaDC3), which imports inside the cell four to six carbon dicarboxylates as well as N-acetylaspartate (NAA). SLC13A3 is mainly expressed in kidney, but also in brain, liver, placenta and eye (PMID: 30635937).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SLC13A3 antibody 26184-1-AP | Download protocol |
| IP protocol for SLC13A3 antibody 26184-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Transcriptomic Profiling Unveils EDN3+ Meningeal Fibroblasts as Key Players in Sturge-Weber Syndrome Pathogenesis | ||
Dev Cell Itaconate uptake via SLC13A3 improves hepatic antibacterial innate immunity
| ||
Bioact Mater An Injectable silk-based hydrogel as a novel biomineralization seedbed for critical-sized bone defect regeneration | ||
Cell Metab Itaconate transporter SLC13A3 confers immunotherapy resistance via alkylation-mediated stabilization of PD-L1 |









