NeuN Polyclonal antibody

NeuN antibodies are widely used as neuronal markers to identify and quantify mature neurons in brain and spinal cord tissue in neuroscience research. Proteintech has an extensive range of NeuN antibodies validated for WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA and Dot blot.

Cat No. 26975-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig and More (2)

Applications

WB, IHC, IF-P, IF-Fro, FC (Intra), Dot blot, ELISA

Fox-1 homolog C, FOX3, HRNBP3, NeuN antigen, Neuronal nuclei antigen

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue, mouse cerebellum tissue, rat cerebellum tissue
Positive IHC detected inmouse cerebellum tissue, rat cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat brain tissue, rat cerebellum tissue, mouse cerebellum tissue
Positive IF-Fro detected inmouse brain tissue
Positive FC (Intra) detected inU-87 MG cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunohistochemistry (IHC)IHC : 1:5000-1:30000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26975-1-AP targets NeuN in WB, IHC, IF-P, IF-Fro, FC (Intra), Dot blot, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig, monkey, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25689

Product name: Recombinant human NeuN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-100 aa of NM_001082575

Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR

Predict reactive species
Full Name hexaribonucleotide binding protein 3
Observed Molecular Weight 46-52 kDa
GenBank Accession NumberNM_001082575
Gene Symbol NeuN
Gene ID (NCBI) 146713
RRIDAB_2880708
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDA6NFN3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Function

NeuN, also known as FOX3 or RBFOX3, belongs to a family of tissue-specific splicing regulators and is involved in neural circuitry balance, as well as neurogenesis and synaptogenesis (PMID: 26619789).

Tissue specificity

NeuN is exclusively present in post-mitotic neurons and is absent from neural progenitors, oligodendrocytes, astrocytes, and glia (PMID: 1483388).

Involvement in disease

· NeuN cytoplasmic localization is increased in the neurons of patients with HIV-associated neurocognitive disorders (PMID: 24215932).

Isoforms

There are 4 isoforms of NeuN, migrating in the 45-50 kDa range (PMID: 21747913).

Post-translational modifications

Currently not known.

Cellular localization

NeuN predominantly localizes to the nucleus but can also be present in the cytoplasm. Isoforms of NeuN differ in their cytoplasmic/nucleus localization (PMID: 21747913).


Protocols

Product Specific Protocols
WB protocol for NeuN antibody 26975-1-APDownload protocol
IHC protocol for NeuN antibody 26975-1-APDownload protocol
IF protocol for NeuN antibody 26975-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

Immunity

Fate mapping of Spp1 expression reveals age-dependent plasticity of disease-associated microglia-like cells after brain injury

Authors - Yangning Lan
mouseIF

Adv Sci (Weinh)

GPR37 Activation Alleviates Bone Cancer Pain via the Inhibition of Osteoclastogenesis and Neuronal Hyperexcitability

Authors - Kaiyuan Wang
mouseIF

Brain Behav Immun

Egln3 expression in microglia enhances the neuroinflammatory responses in Alzheimer's disease

Authors - Jiaxin Guan
mouseIF

Neuron

Astrocytic ApoE reprograms neuronal cholesterol metabolism and histone-acetylation-mediated memory.

Authors - Xiaohui Li
mouseIF

Sci Adv

CGG repeat RNA G-quadruplexes interact with FMRpolyG to cause neuronal dysfunction in fragile X-related tremor/ataxia syndrome.

Authors - Sefan Asamitsu
humanIF

Cell Death Differ

Redox regulation of TRIM28 facilitates neuronal ferroptosis by promoting SUMOylation and inhibiting OPTN-selective autophagic degradation of ACSL4

Authors - Wei Liu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Víct0r (Verified Customer) (07-24-2025)

In my case, this antibody doesn't seem very specific. It binds to cells that are not neurons. However, in pure neuronal cultures, it works well, although there is a bit of background. I’ve just seen that titrating this reagent is recommended, but in this case, it wasn’t titrated.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Cortical neuron culture
NeuN Antibody Immunofluorescence validation (1:200 dilution) in Cortical neuron culture (Cat no:26975-1-AP)
FH

Raquel (Verified Customer) (07-12-2024)

Nice and clean staining. Immunofluorescence analysis in cryostat sections of 4% PFA fixed human brain organoid derived from iPSCs using 26975-1-AP NeuN antibody at dilution of 1:250 (under 20x lens). (Magenta: NeuN ; Blue: DAPI)

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: Human Brain organoids
NeuN Antibody Immunofluorescence validation (1:250 dilution) in Human Brain organoids (Cat no:26975-1-AP)
FH

Manohar (Verified Customer) (03-06-2024)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Neuronal stem cells
FH

Damien (Verified Customer) (02-15-2024)

Works well in 2D staining of induced neurons, starting at 14days. Fixed and permeabilized with 3%BSA and 0.1% Triton

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: Induced neurons
FH

Monika (Verified Customer) (06-08-2023)

Very specific and strong signal. Used without antigen retrieval. Worked good for both NBT/BCIP-colorimetry and Alexa fluor-fluorescence detection.

  • Applications: Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse brain sections (Paraffin embedded)
FH

Russell (Verified Customer) (05-23-2023)

Antigen heat retrieval with Citrate buffer pH 6.0 at 100C for 20 min Permeabilized with 1% TX-100 Blocking Buffer PBST with 5% Donkey Serum

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Brain Organoid
FH

Irina (Verified Customer) (11-18-2021)

Good specific neuronal signal. Works nicely for double IF to look at co-localisation with other proteins.

  • Applications: Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: FFPE Human brain
FH

David (Verified Customer) (01-13-2020)

Good nuclear localisation, with strong signal and low background.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: SH-SY5Y
FH

Maxence (Verified Customer) (09-05-2019)

Labeling was neat without any background. Signal was quite strong and stable.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: Brain
FH

Elena (Verified Customer) (07-31-2019)

Good antibody, stained in all cell lines we used it for.

  • Applications: Western Blot,
  • Cell Tissue Type: HeLA cells, hESCs
FH

Kaspar (Verified Customer) (01-26-2018)

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: mouse
Loading...
||
New chat Able
正在加载,请稍候...