OCT4/POU5F1 Monoclonal antibody

OCT4/POU5F1 Monoclonal Antibody for WB, ELISA

Cat No. 60242-1-Ig
Clone No.1C4B6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, ELISA

OCT4, POU5F1, 1C4B6, OCT3, Oct-3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
HRP
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, Caki-2 cells, human brain tissue, NIH/3T3 cells, HT-1376 cells, NCCIT cells, L02 cells, Neuro-2a cells, mMSCs cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:20000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 41 publications below

Product Information

60242-1-Ig targets OCT4/POU5F1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1794

Product name: Recombinant human OCT4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 102-265 aa of BC020712

Sequence: MCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN

Predict reactive species
Full Name POU class 5 homeobox 1
Calculated Molecular Weight 39 kDa
Observed Molecular Weight 50-52 kDa
GenBank Accession NumberBC020712
Gene Symbol POU5F1
Gene ID (NCBI) 5460
RRIDAB_2881364
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ01860
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Background

Octamer-binding protein 4 (OCT4), also known as POU5F1 or OCT3/4, is a member of the POU gene family and encoded by the human gene POU5F1 (POU domain class 5 transcription factor 1). OCT4 is a member of the Octamer class of transcription factors that recognize the 8-base pair consensus motif 5'-ATGCAAAT-3'. Expression of OCT4 is associated with an undifferentiated, pluripotent stem cell phenotype and tumors. OCT4 is also expressed in the developing brain, with the highest levels found in the cortex, olfactory bulb, and the hippocampus.

 What is the molecular weight of OCT4?

The molecular weight of OCT4 is 38 kDa.

 What are the isoforms of OCT4?

The human POU51F gene consists of five exons located on chromosome 6 and can generate three mRNA isoforms through alternative splicing - OCT4A, OCT4B, and OCT4B1 (PMID: 18787205). OCT4A and OCT4B1 orchestrate gene transcription in the nucleus supporting self-renewal and pluripotency maintenance in ESCs and embryonal carcinoma cells, whereas OCT4B is localized in the cytoplasm in various non-pluripotent cell types and cannot sustain self-renewal and pluripotency.

 What is OCT4's involvement in pluripotency and self-renewal?

OCT4 forms a trimeric complex with SOX2 and DNA to control the expression of genes involved with embryonic development, such as FGF4 (PMID: 10801796), UTF1 (PMID: 10409735), or even NANOG (PMID: 15743839). OCT4 is critical for early embryogenesis (PMID: 9814708) and for embryonic stem cell pluripotency (PMID: 16153702). High levels of OCT4 are associated with the ability to self-renew, which is emphasized by OCT4 gene knockdowns promoting differentiation (PMID: 10742100). OCT4 is also one of the four key transcription factors used to generate induced pluripotent stem cells (iPSCs) by reprogramming fibroblasts to a pluripotent state (PMID: 16904174).



Protocols

Product Specific Protocols
WB protocol for OCT4/POU5F1 antibody 60242-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

EBioMedicine

PMID: 31594754

Authors - Yiyi Liu
humanWB

J Hematol Oncol

A novel lncRNA ROPM-mediated lipid metabolism governs breast cancer stem cell properties.

Authors - Shuiqing Liu

Cell Death Dis

ERCC6L-mediated stabilization of HIF-1α enhances glycolysis and stemness properties of lung adenocarcinoma cells

Authors - Zhimin Lu
humanWB

Theranostics

Sulforaphane Inhibits the Acquisition of Tobacco Smoke-Induced Lung Cancer Stem Cell-Like Properties via the IL-6/ΔNp63α/Notch Axis.

Authors - Chunfeng Xie
humanWB

Cancer Commun (Lond)

KDELR2 promotes breast cancer proliferation via HDAC3-mediated cell cycle progression.

Authors - Haoran Wei
humanWB

CNS Neurosci Ther

NONHSAT141192.2 Facilitates the Stemness and Radioresistance of Glioma Stem Cells via the Regulation of PIK3R3 and SOX2

Authors - Sihan Wang
Loading...
||
New chat

Able

正在加载,请稍候...