OPN1MW Polyclonal antibody, PBS Only

OPN1MW Polyclonal Antibody for WB, Indirect ELISA
Cat No. 30975-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

30975-1-PBS targets OPN1MW in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag34169

Product name: Recombinant human OPN1MW protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-52 aa of BC156776

Sequence: MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWV

Predict reactive species
Full Name opsin 1 (cone pigments), medium-wave-sensitive
Observed Molecular Weight38-40 kDa
GenBank Accession NumberBC156776
Gene Symbol OPN1MW
Gene ID (NCBI) 2652
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDP04001
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

OPN1MW (opsin 1, medium wave sensitive), also known as CBD. It is expected to be located in cell membrane. This gene encodes for a light absorbing visual pigment of the opsin gene family. The encoded protein is called green cone photopigment or medium-wavelength sensitive opsin. Opsins are G-protein coupled receptors with seven transmembrane domains, an N-terminal extracellular domain, and a C-terminal cytoplasmic domain. The long-wavelength opsin gene and multiple copies of the medium-wavelength opsin gene are tandemly arrayed on the X chromosome and frequent unequal recombination and gene conversion may occur between these sequences. X chromosomes may have fusions of the medium- and long-wavelength opsin genes or may have more than one copy of these genes. Defects in this gene are the cause of deutanopic colorblindness. The calculated molecular weight of OPN1MW is 40 kDa.

Loading...
||
New chat Able
正在加载,请稍候...