Tested Applications
| Positive WB detected in | human plasma tissue, HuH-7 cells, human testis tissue | 
| Positive IHC detected in | human liver cancer tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | HepG2 cells | 
| Positive FC (Intra) detected in | HepG2 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:2000-1:20000 | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below | 
Product Information
66097-1-Ig targets ORM1/2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Cited Reactivity | human | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag19248 Product name: Recombinant human ORM1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 25-201 aa of BC026238 Sequence: NLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES Predict reactive species | 
                                    
| Full Name | orosomucoid 1 | 
| Calculated Molecular Weight | 201 aa, 24 kDa | 
| Observed Molecular Weight | 40-47 kDa | 
| GenBank Accession Number | BC026238 | 
| Gene Symbol | ORM1 | 
| Gene ID (NCBI) | 5004 | 
| RRID | AB_2881496 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein G purification | 
| UNIPROT ID | P02763 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
Alpha-1-acid glycoprotein 1 (AGP1), also called orosomucoid-1 (ORM1), is a glycoprotein synthesized mostly by hepatocytes and present in human plasma. ORM1 is an acute-phase reactant protein controlled by glucocorticoids, interleukin-1 and interleukin-6, and increase up to 5-50 times upon infection and/or inflammation. Anti-apoptotic effect and role as immunomodulator of ORM have been reported. ORM is an important carrier for synthetic drugs and influences their distribution and availability in the body. This antibody recognizes a band about 44 kDa in human plasma which may be due to the glycosylation of ORM1 or the dimer formation of the protein. This antibody recognizes both ORM1 and ORM2.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ORM1/2 antibody 66097-1-Ig | Download protocol | 
| IHC protocol for ORM1/2 antibody 66097-1-Ig | Download protocol | 
| WB protocol for ORM1/2 antibody 66097-1-Ig | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 























